KEGG   Dehalococcoides mccartyi GT: DehalGT_1009Help
Entry
DehalGT_1009      CDS       T01182                                 

Definition
(GenBank) enoyl-(acyl-carrier-protein) reductase, putative
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
deg  Dehalococcoides mccartyi GT
Pathway
deg00061  Fatty acid biosynthesis
deg00780  Biotin metabolism
deg01100  Metabolic pathways
deg01130  Biosynthesis of antibiotics
deg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:deg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DehalGT_1009
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DehalGT_1009
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    DehalGT_1009
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:deg01004]
    DehalGT_1009
Enzymes [BR:deg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     DehalGT_1009
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     DehalGT_1009
Lipid biosynthesis proteins [BR:deg01004]
 Fatty acid synthase
  Component type
   DehalGT_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase NTase_sub_bind CCDC158
Motif
Other DBs
NCBI-ProteinID: ADC74370
LinkDB All DBs
Position
965941..966780
Genome map
AA seq 279 aa AA seqDB search
MTQTSYGLLKGKKGIIFGPLNEQSLGWKIALACYREGAELAISNVATALKMGNTADLARI
CGQAPLLVADASSDDELKALFSELKTTLGEIDFIVHSVGISANIRKKIPYESTNYIFYNK
GLEISAISLHKIIRYALEAGVLKDNGSILALTYIGAQRVFSQYNDMNDAKALLEAIARNF
GSRLADRGIRVNTVSQSPTRTSAGSGISNFDAMYEYANLLAPLGNANGEECADYVVTLLS
DLSRKVTMQNLYHDGGFSSAGISEKLLKLLERNQPEAGV
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacgtcttacgggttgctcaagggtaaaaagggaattatattcggcccgcta
aatgagcaaagtctgggctggaaaatagccttggcctgctaccgcgaaggagctgagttg
gctatttccaatgtggccaccgcacttaagatgggcaataccgctgacctggcccggatt
tgcggtcaagcccccctgctggtagctgatgccagcagtgacgatgagcttaaagccttg
ttttccgaactgaaaaccacgctgggagaaatagattttatagtccattcggtgggcata
agtgccaatattcgaaagaaaatcccttacgaatcaaccaattatattttttataacaaa
gggcttgaaatttcggccatatccctccacaaaataatccgatatgcccttgaggccgga
gtactcaaagacaacggcagtatactggctctgacatatattggggcgcaaagggttttt
tcccagtacaacgatatgaatgatgccaaagccctgctggaagcaattgcccgaaatttc
ggttcccgtctggcagaccgcggcatacgggtaaacactgtttcccagtcacctacccgc
acttcggccggttccgggataagcaactttgacgccatgtacgaatatgccaatctgctt
gctccgctgggaaatgcaaacggcgaggaatgtgcggattatgtggttaccctgctttca
gaccttagccgcaaggtaaccatgcaaaacctttaccatgacggcgggttctccagtgca
ggcatctccgaaaaactgctcaagctgctggaacgtaaccagcctgaagccggtgtataa

DBGET integrated database retrieval system