KEGG   Devosia sp. I507: C4375_08300Help
Entry
C4375_08300       CDS       T05346                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
dei  Devosia sp. I507
Pathway
dei00020  Citrate cycle (TCA cycle)
dei00190  Oxidative phosphorylation
dei00650  Butanoate metabolism
dei01100  Metabolic pathways
dei01110  Biosynthesis of secondary metabolites
dei01120  Microbial metabolism in diverse environments
dei01130  Biosynthesis of antibiotics
dei01200  Carbon metabolism
Module
dei_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dei_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dei_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C4375_08300
   00650 Butanoate metabolism
    C4375_08300
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    C4375_08300
Enzymes [BR:dei01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     C4375_08300
    1.3.5.4  fumarate reductase (quinol)
     C4375_08300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer2
Motif
Other DBs
NCBI-ProteinID: AVF03721
UniProt: A0A2L1S5L4
LinkDB All DBs
Position
1726950..1727732
Genome map
AA seq 260 aa AA seqDB search
MAELTLRKADQPQKGKTWPKPEGATRLREFHIYRYDPDKADNPRIDTYFVDLDNCGPMIL
DALLYIKNNTDPTLTLRRSCREGICGSCSMNINGLNTLACTKGMDDSSGPIKIYPLPHMP
VVKDLVPDLTNFYAQHRAIEPWLKTTSPTPEKEWTQSVENRAKLDGLYECILCACCSTSC
PSYWWNGEKYLGPAALLQAYRWLIDSRDETQPERLDNLEDPFKLYRCHTIMNCAKVCPKG
LNPAKAIAQIKKMMVERKAA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactgacgttgcgcaaggccgatcagccgcagaagggcaagacctggcccaag
ccggaaggggcgacgcgcctgcgcgaattccatatctatcgctatgatccggacaaggcg
gacaatccgcggatcgacacctattttgtcgacctcgacaattgcgggccgatgatcctg
gatgccctgctctacatcaagaacaacaccgacccgaccctgacgctcaggcgctcttgc
cgcgagggcatttgcgggtcctgctcgatgaatatcaacgggctcaacaccctggcctgc
accaagggcatggacgacagctccggcccgatcaagatctacccgctgccgcatatgccg
gtggtcaaggacctggtgccggacctgaccaatttctatgcccagcaccgggccatagag
ccctggctcaagaccacctcgcccacgccggaaaaggaatggacacagtcggtcgaaaac
cgcgccaagctcgacgggctctatgagtgcattttgtgcgcctgctgctcgacctcctgc
ccgtcctattggtggaatggcgagaaatatctgggccccgcggcgttgctgcaggcctat
cgctggctgatcgacagccgtgatgaaacccagcccgaacgtctcgacaacctcgaagac
cctttcaagctctatcgctgccacaccatcatgaactgtgccaaggtctgccccaagggg
ctgaacccggccaaggcgattgcacagatcaagaagatgatggtggagcgcaaggctgcc
tga

DBGET integrated database retrieval system