KEGG   Devosia sp. I507: C4375_09420Help
Entry
C4375_09420       CDS       T05346                                 

Definition
(GenBank) bifunctional ornithine acetyltransferase/N-acetylglutamate synthase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
dei  Devosia sp. I507
Pathway
dei00220  Arginine biosynthesis
dei01100  Metabolic pathways
dei01110  Biosynthesis of secondary metabolites
dei01130  Biosynthesis of antibiotics
dei01210  2-Oxocarboxylic acid metabolism
dei01230  Biosynthesis of amino acids
Module
dei_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:dei00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    C4375_09420
Enzymes [BR:dei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     C4375_09420
    2.3.1.35  glutamate N-acetyltransferase
     C4375_09420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ PDZ_6
Motif
Other DBs
NCBI-ProteinID: AVF03920
UniProt: A0A2L1S666
LinkDB All DBs
Position
complement(1946338..1947573)
Genome map
AA seq 411 aa AA seqDB search
MAAHPVSPLAPKSYPDLPAIAGVRFATAEAGIKYKNRTDVLLMAFDEGTVAAGVLTRSKC
SSAAVDWCRANLPGGKARGLVVNSGNANAFTGTKGKDSVQQTAEIAAKALGCSTGEIFLA
STGVIGEPLDASKFAGVLDETATRMAATPWIDPAKAIMTTDTYPKLSGAVLEIDGVEVKI
NGIAKGSGMIAPDMATMLSFVVTDMPIAAEVLQALLVRHNQTSFNAITVDSDTSTSDTLL
AFATGKAGVEPILSLEDPRAEIFGQALSDVLFELAIHVVRDGEGATKQVSVHVEGAVSDE
SAFRIAKSIADSPLVKTAIAGEDANWGRVVMAVGKAGEPADRDKLAIRFGDLVVARNGER
ATGYDEAATSAYMKGEELELTVSLGLGAGAATVYTCDLTHGYITINGDYRS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccatccggtttctcccctcgcccccaaatcttatccggacctgcctgcaatc
gcaggcgtgcgctttgccaccgccgaagcgggcatcaaatacaagaaccgcactgacgtg
ctgctgatggcctttgacgaaggcactgtcgccgccggcgtgcttacccgctccaaatgc
tcttcggccgctgtcgactggtgccgcgccaatctgccaggcggcaaggcgcgtggcctg
gtggtcaattcgggcaatgccaatgcctttaccgggaccaagggcaaggactccgtgcag
cagaccgccgaaattgccgccaaggcgctgggctgttcgaccggcgagattttcctcgcc
tccaccggcgtcatcggcgaaccgctcgacgcctccaaatttgccggcgtgctggacgaa
accgccacgcgcatggccgccaccccctggatcgatccggccaaggcgatcatgaccacc
gacacctatcccaagctttcgggcgccgtgctcgagatcgacggggtcgaggtcaaaatc
aacggcatcgccaagggctcgggcatgatcgcgccggacatggccaccatgctcagcttc
gtggtcaccgacatgcccattgctgccgaagtgctccaggccctgctggtcaggcacaac
cagaccagcttcaatgccatcaccgtcgacagcgacacctcgacctccgacacgttgctg
gccttcgccaccggcaaggccggtgtcgaacccatattgagcctcgaagatccgcgtgcc
gagatcttcggtcaggccctgtccgacgtcctgttcgagctcgccatccatgtggtccgc
gacggcgaaggcgccaccaagcaggtctcggtgcatgttgaaggcgcggtttccgatgaa
agcgccttccgcatcgccaaatccattgcggattcgcctctggttaagaccgccatcgcc
ggtgaggatgccaattgggggcgcgtggtcatggccgtgggcaaggcaggcgaaccggcc
gaccgcgacaagctcgccatccgcttcggcgacctggtcgtggcccgcaatggcgagcgc
gccaccggctatgacgaggccgccaccagcgcctatatgaagggcgaagagcttgagctg
accgtgtccctcggcctcggcgcaggtgcagccacggtctatacctgcgacctcacccac
ggctacatcaccatcaatggcgactaccggagctaa

DBGET integrated database retrieval system