KEGG   Devosia sp. I507: C4375_09480Help
Entry
C4375_09480       CDS       T05346                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
dei  Devosia sp. I507
Pathway
dei00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dei01100  Metabolic pathways
dei01110  Biosynthesis of secondary metabolites
dei01130  Biosynthesis of antibiotics
dei01230  Biosynthesis of amino acids
Module
dei_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:dei00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    C4375_09480
Enzymes [BR:dei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     C4375_09480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 TsaE AAA_16 dNK AAA AAA_22 Cytidylate_kin AAA_5 AAA_28 RsgA_GTPase Mg_chelatase SRP54 AAA_17 CoaE
Motif
Other DBs
NCBI-ProteinID: AVF03931
UniProt: A0A2L1S669
LinkDB All DBs
Position
1959921..1960508
Genome map
AA seq 195 aa AA seqDB search
MSRTDGGGRQGRARALASRLNGRPLVLVGMMGAGKTTVGRRLAARLGRQFIDSDEEIERA
AQMSIPEIFEQRGEGEFRAGEMRVIARLLKEKDIVLATGGGAFVNSDTRALVKAGAVSVW
LKADLDLLFERVSRRANRPLLKTADPKGTLEKLIADRYPIYAEADLTVVSRDVPQDNVAG
DVITALLDHFKKEQA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttgagcagaacggatggcggcggacggcagggccgggcccgggcattggccagccggctg
aatggccgaccactggtgctcgtgggcatgatgggggccggcaagaccactgtgggccgg
cgccttgccgctcgtctgggccgccagttcatcgacagcgacgaggaaatcgaacgcgcc
gcgcaaatgagcattcccgaaatcttcgagcagcgcggcgagggcgagtttcgtgccggg
gaaatgcgggtgattgcccggttgctcaaggaaaaggacatagtcctggccaccgggggc
ggcgccttcgtcaattccgacaccagggcgctggtcaaggccggtgccgtgtcggtctgg
ctcaaggccgatctggacctgttgttcgaaagggtgtcgcgccgcgccaaccggcctttg
ctcaagacagccgaccccaagggaacactcgaaaaactgattgcggaccgctatccgatc
tatgccgaggcggatctgaccgtggtcagccgcgatgtgccgcaggacaatgtagcaggg
gacgtcattacggccctgctcgaccacttcaagaaagagcaagcctga

DBGET integrated database retrieval system