KEGG   Devosia sp. I507: C4375_10120Help
Entry
C4375_10120       CDS       T05346                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
dei  Devosia sp. I507
Pathway
dei03030  DNA replication
dei03410  Base excision repair
dei03420  Nucleotide excision repair
dei03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:dei00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    C4375_10120
   03410 Base excision repair
    C4375_10120
   03420 Nucleotide excision repair
    C4375_10120
   03430 Mismatch repair
    C4375_10120
Enzymes [BR:dei01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C4375_10120
    6.5.1.6  DNA ligase (ATP or NAD+)
     C4375_10120
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     C4375_10120
DNA replication proteins [BR:dei03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    C4375_10120
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     C4375_10120
DNA repair and recombination proteins [BR:dei03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     C4375_10120
   NER (nucleotide excision repair)
    Other NER factors
     C4375_10120
   MMR (mismatch exicision repair)
    Other MMR factors
     C4375_10120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AVF04039
UniProt: A0A2L1S6K0
LinkDB All DBs
Position
2091518..2093083
Genome map
AA seq 521 aa AA seqDB search
MKRFAELLELLALTPSRTRKIAALAQYFAEVPDPDRGLALAVLTGELDIANVKPALLKQT
VLAEVDETLFALSYDYVGDLGETIALIWPHHGTGELPRLSALVELLNTTSKAELPKLIGG
LLTQAAIHERWALIKLATGALRIGVSARLAKTALAEMSGVELQAIEEVWHGLKPPYAALF
AWLEGKTGRPEVDHTARFHPLMLSTPIEESDFEKLDPRDFAAEWKWDGIRVQLVLGRNGA
SLFSRTGDDIAPSFPDVVDAAMGRAVLDGELLVGHDFAPRSFNDLQQRLNRKQASARQMA
ELPGFVRVYDMLFDGDEDIRALGWQARRARLEAWFDQNPQARLDLSEVLGFTAWEDVASL
RRQGAESHGHEGVMLKLRTAPYVPGRPKGFWFKWKRDPNVVDAVLMYAQRGHGKRSSFYS
DYTFGVWKGNEIVPIGKAYFGFTDEELKQLDRWIRANSIGSFGPVREVKKELVFEVAFDS
AQKSTRHKSGVALRFPRINRIRWDKPASEAARLEDMDAFVG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttttgcagaattgctcgaactcctggccctcaccccatcgcgcacgcgaaaa
atcgcggccctggcgcagtattttgccgaggtgccggacccggatcgcggccttgcgctg
gccgtgctgaccggcgaactcgacattgccaatgtcaagccggccctgctcaagcaaacc
gtcctggcggaagtggatgaaacgctgtttgcgctctcctatgactatgtcggggatttg
ggcgaaaccattgcgttgatctggccgcatcacgggacaggtgagttgccgcggctgagc
gccttggtggagctgctcaacaccaccagcaaggcggagctgcccaagctgattggtggt
ctgctgacgcaagccgcgatccatgagcgctgggcgctgatcaagctggcaaccggcgcg
ctgcgcattggcgtgtcggcacggctggccaagacggcactggccgaaatgagcggggtg
gagctgcaggccattgaagaggtctggcatgggctcaagccgccctatgcggccttgttc
gcctggctggaaggcaagaccggacggccggaggtggatcacacggcgcggtttcatccc
ctgatgctctccacgccaatcgaggagagcgatttcgaaaagcttgatccacgcgacttc
gccgccgaatggaaatgggacgggataagggtgcagcttgtgctggggcgcaacggtgca
tcgctgttttcgcgcacgggcgacgacatcgcgccgagctttcccgatgtggtcgatgcc
gccatggggcgggcggtgctggacggcgaattgctggtcgggcacgatttcgcgccgcgc
agtttcaatgacctgcagcagcggctcaatcgcaagcaggccagcgccaggcaaatggcc
gagctgcccggctttgtgcgggtctatgacatgctgttcgatggcgacgaggacatcagg
gcgctgggttggcaagctcggcgggcgcggctggaggcatggttcgaccagaacccgcag
gcccggctggatctgtcagaggtgcttggtttcaccgcctgggaggatgttgccagcttg
cggcggcagggggcggaaagccacggccatgagggggtaatgctcaagctcaggaccgcg
ccctatgtgccgggccggcccaaggggttctggttcaagtggaagcgcgatcccaatgtg
gtcgatgcggtgctgatgtatgcccagcgcgggcatggcaagcggagctcgttctattcc
gactacacattcggagtgtggaagggcaatgagattgtccccatcggcaaggcctatttc
ggtttcaccgatgaggagctgaaacagctcgaccgctggatccgggccaattcgatcggc
agtttcgggccggtgcgcgaagtgaagaaggagctggtgttcgaggtggcgttcgacagt
gcgcagaaaagcacaaggcacaaatcgggcgtggcgctgcgctttccgcgcatcaaccgg
atacgctgggacaagccggccagtgaggctgcacgacttgaagacatggatgcatttgtg
gggtga

DBGET integrated database retrieval system