KEGG   Devosia sp. I507: C4375_14525Help
Entry
C4375_14525       CDS       T05346                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
dei  Devosia sp. I507
Pathway
dei00500  Starch and sucrose metabolism
dei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C4375_14525
Enzymes [BR:dei01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     C4375_14525
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     C4375_14525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AVF04794
UniProt: A0A2L1S8N9
LinkDB All DBs
Position
complement(2976880..2978511)
Genome map
AA seq 543 aa AA seqDB search
MANLWYKNAIVYCVDVKSFMDANGDGTGDFVGLADRLDHLERLGVTCIWLNPFYPSPRRD
NGYDISDYYGIDPALGTLGDFVEFIEAAKDRGMRVIVDLVVNHTSDQHPWFQAARTDPNS
PYRDWYVWRDEKPDNITDGIVFPGVQKATWTYDRTAKAWYMHRFYKFQPDLNTANPAVRQ
EILKIMGFWLALGVSGFRVDAVPFLIEPRGVLTDKPVVDPHAMLTEIHDFLSWRKAEAIL
LAEANISYEEAPDYFAAGDRMTMVFDFVGNQQLFLSLARKTAAPLRRSLAARPDPQGMGQ
WAVFLRNHDELNLGNLTEQEREQCFAAFGPEPDMQIYDRGLRRRLASMFDGDETRLKMAF
SLLLALPGTPVIWYGDEIGMGEDLALPEREAVRTPMQWSPGHNGGFSEAPKDELVRPAID
SGKFGYHHINAAMQTQHRNSFFHAIADMVSARRSSPEIGWGGVDIVDVGDDELLVLSSHW
RGNRVITAHNFAGTPKSFHLADEGIEELMPMLTDSPTGPIKGDGEIALSAYGYCWLRCNG
ERR
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccaatctctggtacaagaacgcaatcgtctattgcgtcgatgtcaaaagcttcatg
gatgccaatggcgacggcaccggcgatttcgtcgggctggccgacaggctcgatcacctc
gagcggctgggcgtcacctgtatctggctcaatccattctacccgtcaccacgacgcgac
aatggctacgacatctccgactattacggcatcgaccccgcgcttgggacgctgggggat
ttcgtcgagttcatcgaagcggccaaagatcgcggcatgcgggtgattgtcgaccttgtc
gtcaaccatacctccgaccagcatccctggtttcaggctgcccggaccgacccgaactcg
ccctaccgcgactggtatgtctggcgcgacgaaaaaccggacaatatcaccgacggcatt
gtctttcccggtgtgcagaaggccacctggacgtatgaccggaccgccaaggcctggtac
atgcaccgcttctacaagttccagccggacctcaatacggccaatcccgccgtgcggcag
gaaatcctcaagatcatggggttctggctggcgctgggcgtgtcaggctttcgggttgat
gccgtgccgtttctgattgagccgcgcggcgtgctgacggacaagccggtcgtcgacccc
catgccatgctgaccgagatccacgacttcctgtcctggcgcaaggccgaagccattctg
ctggccgaggccaatatcagctacgaagaagcacccgactattttgccgccggagaccgc
atgacaatggttttcgactttgtcggcaaccagcaattgttcctctccctggcccgcaag
accgccgctcccctgcgccgttcgttggccgcgcggcccgacccgcaaggcatgggccaa
tgggccgtctttctgcgcaaccatgacgagctgaacctggggaaccttaccgaacaagag
cgcgagcagtgtttcgccgccttcgggcccgaaccggacatgcagatctatgaccgcggc
ctgcggcgccggctcgccagcatgttcgatggggacgagacgcgcctgaaaatggcgttc
tcgctattgctggccctgcccggcacacctgtcatctggtatggtgacgagatcggcatg
ggggaagacctggccctgcccgaacgcgaagccgtccgtacgccgatgcaatggtcgcca
gggcacaatggtgggttctcggaggcgccgaaagacgagcttgtccggccggcgatcgac
agcggcaagttcggctatcatcacatcaacgccgcgatgcagacccagcaccgcaattcg
ttcttccatgccattgccgatatggtgtcggcacgccgctcgtcgccggaaatcggctgg
ggtggtgtcgatattgttgatgtgggggacgatgaattgctcgtgctctccagccactgg
cgcggcaatcgagtgatcaccgcccataattttgccggcacgcccaaatcatttcatctg
gccgatgaaggtatcgaagaactcatgccgatgctgaccgattcaccgaccggaccgatc
aagggcgatggcgaaatcgcgctgtccgcctatggctattgctggctgcgctgcaatggc
gagcgacgctaa

DBGET integrated database retrieval system