KEGG   Devosia sp. I507: C4375_14755Help
Entry
C4375_14755       CDS       T05346                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dei  Devosia sp. I507
Pathway
dei00473  D-Alanine metabolism
dei00550  Peptidoglycan biosynthesis
dei01100  Metabolic pathways
dei01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dei00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C4375_14755
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C4375_14755
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    C4375_14755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dei01011]
    C4375_14755
Enzymes [BR:dei01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C4375_14755
Peptidoglycan biosynthesis and degradation proteins [BR:dei01011]
 Precursor biosynthesis
  Amino acid ligase
   C4375_14755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AVF04833
UniProt: A0A2L1S8S5
LinkDB All DBs
Position
3023869..3024789
Genome map
AA seq 306 aa AA seqDB search
MSKHVAVLMGGWSNERPVSLSSGTECAAALRRAGYRVTEVDVGRDIANVLAELKPDVAFN
ALHGPFGESGMIQGLLELMQIPYTHSGVLASALAMDKHQAKIMLKSAGVPVTDHVVVHRA
EAGRAHVMPPPYVIKPIADGSSFGVFIVKGDTSHPPQEILREDWNSGEEVMVERYIPGRE
LTCAVMGDVALGVTEIVTELNFYNFEAKYAEGGSVHVIPADLKPKIYDKVQKMALAAHAA
LGCRGVTRSDFRYNDAVGEDGELVCLEINTQPGMTPTSLVPEQAAHAGHSYEELVAWMVE
DASCNR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcatgtcgccgtcctgatgggcgggtggtccaatgagcgcccggtttcgctg
agttcgggaacggaatgcgcggcggccttgcggcgggctggctaccgggtcaccgaggtc
gatgtcgggcgcgatattgccaatgtactggcggagctcaagcccgatgtggcgttcaat
gcgctacatgggccgtttggcgagagcgggatgatccaggggctgcttgagctgatgcag
attccctatacccattcgggggtgctggcctcggcgctggcgatggacaagcaccaggcc
aagatcatgctcaaatccgccggggtgccggtgaccgaccatgtcgtggtccaccgggcc
gaagcgggcagggcgcatgtgatgccgccgccctatgtgatcaagccgattgccgatggg
tcgagctttggcgtcttcatcgtcaagggcgacaccagccatccgccgcaggagatcctg
cgagaggactggaactcgggcgaagaggtgatggtggagcgctacattcccggtcgggag
ctgacctgtgcggtgatgggcgacgtggcgctgggggtgaccgagatcgtcaccgagctg
aacttctacaatttcgaggcgaaatacgccgaaggtgggtccgtgcacgtcattccggcc
gatctgaaaccgaaaatttacgacaaagtgcagaagatggcattggccgcccatgcggct
ctcggctgccgcggcgtgacccgttccgatttccggtacaacgatgcggtaggcgaagat
ggcgaactggtctgtctggaaatcaacacccagccaggcatgacgccgacctcactggtg
cccgagcaggcggctcacgccgggcactcctacgaagagctggtcgcctggatggtggag
gacgcgagttgcaacaggtaa

DBGET integrated database retrieval system