KEGG   Devosia sp. I507: C4375_16495Help
Entry
C4375_16495       CDS       T05346                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
dei  Devosia sp. I507
Pathway
dei00010  Glycolysis / Gluconeogenesis
dei00620  Pyruvate metabolism
dei01100  Metabolic pathways
dei01110  Biosynthesis of secondary metabolites
dei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C4375_16495
   00620 Pyruvate metabolism
    C4375_16495
Enzymes [BR:dei01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     C4375_16495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AVF05141
UniProt: A0A2L1S9N4
LinkDB All DBs
Position
complement(3370032..3371552)
Genome map
AA seq 506 aa AA seqDB search
MNKPEFVGQRTKSPYKAKYGNYIGGQWVDALDGETFENTSPVTGQVICEVARSKAADVER
ALDAAHKAAPGWGQTSVAQRAVMLNKIADRMEEHLDEIALAETWDNGKPIRETTAADIPL
AIDHFRYFAGAIRAQEGGISELDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPALA
AGNAVVLKPAEQTPASILFLMELIEDILPPGVVNIVNGFGLEAGKPLASSNRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVLAEDDDFFDKALEGFAMFALNQGEV
CTCPSRALIQESVYDRFMERAIKRVEAIKQGSPFEMSTMIGAQASSEQLEKILSYLDIGR
QEGATVLTGGERNNLGGELAGGYYVKPTVFAGNNKMRIFQEEIFGPVVSVTTFKTDAEAL
EIANDTLYGLGAGVWTRDANRAYRFGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HRMMLDHYQQTKNMLVSYSPKKLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacctgaattcgtcggccagcggaccaagtctccgtacaaggcgaaatacggc
aattatatcggcgggcagtgggtggacgcgctcgacggcgagaccttcgagaacacctcg
ccagtcactgggcaggtgatttgcgaagtcgcgcgctccaaggcggcggatgtcgagcgg
gcgctggatgcggcccataaggccgcgccgggctggggccaaacctcggtggcgcagcgc
gcggtgatgctcaacaagattgccgatcgcatggaagaacatctcgacgagatcgcgctg
gccgagacctgggacaatggcaagccaattcgtgagacgactgctgccgatattccgctg
gcgatcgaccacttccgctatttcgccggtgccatccgcgcccaggagggcggcatttcc
gaacttgaccatgacacggtggcttatcatttccacgagcccctcggcgtcgtggggcag
atcattccgtggaacttccctatcctgatggcggtctggaaactggcgcccgcgctagcg
gcaggcaatgccgtggtgctcaagcctgccgagcagacgccggcatcaatcctctttctc
atggaattgatcgaagacatcctgccgcccggcgtggtcaatatcgtcaacggctttggc
cttgaagccggcaagccgctggccagctcgaaccgcatcgccaagatcgcctttaccggc
gagaccacgacgggccggctgatcatgcaatatgccagccagaacctgatcccggtgacg
ctggaacttggtggcaaatcgccgaacatcttctttgccgacgtattggccgaagacgat
gatttcttcgacaaggcgctcgagggctttgccatgttcgcgctcaatcagggcgaggtg
tgtacctgcccgagccgcgccctgatccaggaaagcgtctatgaccgcttcatggaacgg
gcgatcaagcgggtggaagccatcaagcagggttctcccttcgagatgagcacgatgatc
ggggcccaggcctcgtccgagcaactcgagaaaattctctcctatctcgatatcggccgg
caggaaggcgccacggtgctgactggcggcgagcgcaacaatctgggtggcgagttggcg
ggtggttactacgtcaagccgacggtgtttgctggcaacaacaagatgcgcattttccag
gaggaaatctttggcccggtggtctcggtgacgaccttcaagaccgatgccgaagccctc
gagatcgccaatgacacgctttatggcctgggcgccggcgtgtggacgcgtgatgccaac
cgggcctatcgcttcggccgaggcatccaggcggggcgcgtatggaccaattgctatcac
gcctatcctgcccatgccgcctttggtggttacaagcagagcggcatcggacgcgaaaac
caccgcatgatgcttgaccactaccagcagaccaagaacatgctggtgagctactcgccc
aagaagctgggcttcttctaa

DBGET integrated database retrieval system