KEGG   Pseudodesulfovibrio indicus: AWY79_04695Help
Entry
AWY79_04695       CDS       T04404                                 

Definition
(GenBank) ornithine acetyltransferase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
dej  Pseudodesulfovibrio indicus
Pathway
dej00220  Arginine biosynthesis
dej01100  Metabolic pathways
dej01110  Biosynthesis of secondary metabolites
dej01130  Biosynthesis of antibiotics
dej01210  2-Oxocarboxylic acid metabolism
dej01230  Biosynthesis of amino acids
Module
dej_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:dej00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AWY79_04695
Enzymes [BR:dej01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     AWY79_04695
    2.3.1.35  glutamate N-acetyltransferase
     AWY79_04695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AMK10463
UniProt: A0A126QKA7
LinkDB All DBs
Position
1018216..1019397
Genome map
AA seq 393 aa AA seqDB search
MKIPAGYLFAATAASFKKPGKLDLGAIVSDVPAVAAGVFTTNKFKAAPVLQCKEMLADGR
KMSGFLVNSGQANACTGDQGRANCRETLNLAASHLGVPADELLPASTGVIGAQFDMAKWE
AAMPALAGTLGHAGPEDTARAIMTTDTVHKLAEASFALKNGEVRLLGMCKGAGMISPNMA
TMLSFIVCDADISAEAWQVMLTDCVNLTINRVTVDGDMSTNDCVMALANGMSGVAIESEE
DYILLRKHLLSVLEELAYKIVMDAEGGTKVAFIEVSGAKSDEDAEKVARAVGNSPLVKTA
LFGSDPNWGRIICAAGYSGADFKPEDLVLKIGGVLVFRNGTPEPGDMDGLLKPIMKERDI
VIHIDVGDGPGSTMLLASDLTRDYISINADYRS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacccgcaggatatctgttcgccgccactgcggcgtccttcaagaagcccggc
aagctcgacctgggcgccatcgtcagcgatgtccccgccgttgccgcgggcgtgttcacc
accaataaattcaaggccgcgccggtgctccaatgcaaggagatgctggccgacggtcgc
aagatgtccggtttcctggtcaactcgggccaggccaacgcctgcaccggcgaccagggc
cgcgccaactgccgcgagaccctgaacctggcggcgagccatctgggcgtgcccgcggac
gagctcctgcccgcctccaccggggtcatcggcgcgcagttcgacatggccaagtgggag
gcggcgatgcccgccctggccgggactctgggccacgccggtccggaggacacggcccgc
gcgatcatgaccacggacaccgtgcacaagctggccgaagcgtccttcgcgctgaagaac
ggcgaggtccggctgctcggcatgtgcaagggtgcgggcatgatctccccgaacatggcc
accatgctctcgttcatcgtctgcgacgcggacatctccgccgaggcgtggcaggtcatg
ctgaccgactgcgtgaacctgaccatcaaccgagtgaccgtggacggcgacatgtccacc
aacgactgcgtcatggccctggccaacggcatgtcgggcgtggccatcgagagcgaggag
gattacatcctgctgcgcaagcacctgctctcggtgctggaggagctggcgtacaagatc
gtcatggacgccgagggcggcaccaaggtggccttcatcgaggtctccggggccaagtcc
gacgaggacgccgagaaggtggcgcgcgccgtgggcaactccccgctggtcaagaccgcg
ctgttcggctcggaccccaactggggacggatcatctgcgcggcgggctattccggcgcg
gacttcaagcccgaggacctggtgctcaagatcggcggcgtgctggtcttccgcaacgga
accccggagccgggcgacatggacgggctgctcaagccgatcatgaaggagcgcgacatc
gtcatccacatcgacgtgggcgacggccccggctccaccatgctcctggccagcgacctg
acccgtgactacatttccatcaacgcggactaccgcagctaa

DBGET integrated database retrieval system