KEGG   Pseudodesulfovibrio indicus: AWY79_09490Help
Entry
AWY79_09490       CDS       T04404                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
dej  Pseudodesulfovibrio indicus
Pathway
dej00550  Peptidoglycan biosynthesis
dej01100  Metabolic pathways
dej01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:dej00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AWY79_09490
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AWY79_09490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dej01003]
    AWY79_09490
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dej01011]
    AWY79_09490
Enzymes [BR:dej01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AWY79_09490
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AWY79_09490
Glycosyltransferases [BR:dej01003]
 Polysaccharide
  Bacterial polysaccharide
   AWY79_09490
Peptidoglycan biosynthesis and degradation proteins [BR:dej01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AWY79_09490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AMK11330
UniProt: A0A126QMM0
LinkDB All DBs
Position
2150760..2153108
Genome map
AA seq 782 aa AA seqDB search
MKKFLKIFGIVVLVCFLLGIGGAIAVYQWAAKDLPGFKNITDYNPPLVTTVYAKDNQVLG
YFYKEKRFLVTLDQMSEWVPKAFLAAEDASFYQHDGVDMTAIVRAFKANLMAGRTKQGGS
TITQQVIKRLLLTSERSYERKLKEAILAFRLENYLTKEEILTIYLNHIFLGAHSYGVEAA
SRTYFAKHAKDLTIAQAAMIAGLPQAPTRYNPYQNFDLARQRQEYVLGQMRRLGWITDAQ
YEEAMAEPIELKSMDDPSWQTGAYYLEEVRRWLIDQYGEDAVYNGGLTVTTPCDLKHQAA
AEKALRRGLIDSAKRRGWLGPEGHFTPADEPAVLAEGPQSTEGITDKDRLMKAFVTSVSQ
DKATVKFGRFRGEIPVKAMWWVREPDPKKSHEDAPDPTDARKVLKKGDVVWVTVAEAPKK
EDGVWMLDLEREPKVEGGLVSMKPDTGEVLALVGGYSFGKSQFNRATQAKRQPGSAFKPI
VYSAAIDNGFTAASIVLDAPIVYANDAEGKLWRPENYEGSFEGPTLLRTALVKSKNLCTI
RVAQRIGIRTIIDRARAMGLESDFPPDLSVSLGSSVVTLMNLCEAYTTFPRGGSYIKPRT
VLSVKSAWGEELFSSKPETVDAISPQTAYIMATLMKQVVQYGTGWRARVLGRPLAGKTGT
SNMEQDAWYMGYAPYLLTGVYVGFDELTPMGKWETGSRAASPIWVDYRKQVEDDYPYEDF
TQPPGIVMVRVDGKTGKLATPSSSEEYFLPFKVGSEPTETAPSSGANGEGPASDDDLFKQ
TF
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttctcaagatattcggcatcgtggtcctggtctgtttcctcctcggcatc
ggcggcgccatcgccgtctaccagtgggccgccaaggaccttcccggcttcaagaacatc
accgattacaatccgcccctggtgaccacggtttacgccaaggacaaccaggtgctcggc
tacttctacaaggagaagcggttcctggtcaccctggaccagatgagcgagtgggtcccc
aaggcgttcctggccgccgaggacgccagcttctaccagcacgacggggtggacatgacc
gccatcgtccgcgccttcaaggccaacctcatggccgggcgcaccaagcagggaggctcg
accatcacccagcaggtgatcaagcggctgctcctgacctccgagcgcagctacgagcgc
aagctcaaggaggccatcctcgccttccgtctggagaactacctgaccaaggaagagatc
ctgaccatctacctgaaccacatcttcctcggggcgcactcctacggcgtggaggccgcc
tcccgcacctatttcgccaagcacgccaaggacctgaccatagcccaggcggccatgatc
gccgggctgccccaggctcccacgcgctacaatccgtaccagaattttgatctcgcccgg
cagcgccaggaatacgtcctcggccagatgcgccggctcggatggatcaccgacgcccag
tacgaggaggccatggccgagcccatcgagctcaagtccatggacgacccgtcctggcag
accggcgcctactaccttgaggaggtccgccgctggctcatcgaccagtacggcgaggac
gcggtctacaacggcggcctgaccgtcaccaccccgtgcgacctgaagcatcaggccgcc
gcggaaaaggcgctgcggcgcgggctgatcgattcggccaagcggcgcggctggctcggc
cccgaaggccatttcactccggcggacgaacccgccgtcctggccgaaggtccccagtcc
accgaggggataacggacaaggaccggctgatgaaggcgttcgtcacctccgtctcccag
gacaaggccacggtcaaattcggccggttcaggggcgagattccggtcaaggccatgtgg
tgggtgcgcgaacccgatcccaagaagagccatgaggacgcccccgacccgaccgacgcc
cgcaaggtgctcaagaagggcgacgtggtctgggtcacggtggccgaagctcccaagaag
gaggacggcgtctggatgctcgacctggagcgcgagcccaaggtggagggcggcttggtc
tccatgaagcccgataccggcgaggtcctggccctggtgggcggctattccttcggcaag
agccagttcaaccgggccacccaggccaagcgccagcccggctccgcgttcaagcccatc
gtctattccgcggccatcgacaacggcttcaccgccgcctccatcgtgctcgacgcgccc
atcgtctacgccaatgacgccgagggcaagctgtggcggcccgagaactacgaggggtcc
ttcgagggcccgaccctgctgcgcaccgccctggtcaagtccaagaacctgtgcaccatc
cgcgtggcccagaggatcggcatccggaccatcatcgaccgcgccagggccatgggcctg
gagtccgattttccgccggacctctccgtgtccctgggctcgtccgtggtcacgctcatg
aatctgtgcgaggcgtacaccaccttcccgcgcggcggctcctacatcaagccgcgcacg
gtcctgtccgtgaaatccgcctggggagaggaacttttctcctccaaaccggagactgtg
gacgccatcagcccccagaccgcgtacatcatggccaccctgatgaagcaggtggtccag
tacggcaccggctggcgggcgcgggtgctgggcaggcccctggcgggcaagaccggcacc
tccaacatggagcaggacgcctggtacatgggctacgccccgtacctcctgaccggcgtg
tacgtcggcttcgacgagctgactcccatgggcaagtgggagaccggttcgcgcgcggcc
agccccatctgggtggactaccgcaagcaggtcgaggatgattatccctacgaggacttc
acccagccgccgggaattgttatggtccgcgtggacggcaagaccggaaagctggccacc
ccgtcctcgtcggaggaatacttcctgccgttcaaggtgggttccgagcccacggagacg
gcaccgtcctccggcgccaacggggagggaccggcctccgacgacgacctgttcaagcaa
accttctag

DBGET integrated database retrieval system