KEGG   Delftia sp. Cs1-4: DelCs14_0046Help
Entry
DelCs14_0046      CDS       T01497                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
del  Delftia sp. Cs1-4
Pathway
del00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:del00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DelCs14_0046
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:del02000]
    DelCs14_0046
Enzymes [BR:del01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DelCs14_0046
Transporters [BR:del02000]
 Other Transporters
  Pores ion channels [TC:1]
   DelCs14_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_3 GST_C_2 GST_C_3 GST_N GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AEF87088
UniProt: F6AYT2
LinkDB All DBs
Position
complement(49201..49809)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIVLHEAGLAYEPVLASTKTHKLQDGTDYYGINPLGYVPFLVLDDG
DTLHEGPAIVQYLADLVPEKKLAPANGTMARYHLQEWLNFIGTELHKGFGPLFNPATPDD
YKPVVRQRVLDRLKWVDGELNGRDYLMGEQFTVADAYLFTVTGWAQFVGVDISELTNLLA
YRERVLARPAVQAAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacagccctggcgcctgctctctgtctccccacatcgtcctgcacgag
gcagggctggcctacgagccggtcctggccagcaccaagacgcacaagctgcaggacggc
acggactactacggcatcaacccgctgggctatgttcccttcctcgtgctcgacgacggc
gacacgctgcatgaaggcccggccatcgtccagtacctggccgatctggtccccgagaag
aagctggcgcctgccaacggcaccatggcccgctaccaccttcaggagtggctgaacttc
atcggcaccgagctgcacaagggcttcggccccctgttcaaccccgccacgcccgacgac
tacaagcccgtggtgcgccagcgtgtgctggaccgcctcaagtgggtggacggcgagctc
aatggccgcgactacctgatgggcgagcagttcaccgtggccgacgcctacctgttcacc
gtgacgggctgggcccagttcgtgggcgtggacatctccgagctgaccaacctcctggcc
taccgcgagcgcgtgctggcccgccctgccgtgcaggccgcgatgaaggccgaaggcctg
ctcaagtaa

DBGET integrated database retrieval system