KEGG   Delftia sp. Cs1-4: DelCs14_0446Help
Entry
DelCs14_0446      CDS       T01497                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
del  Delftia sp. Cs1-4
Brite
Translation factors [BR:del03012]
 Eukaryotic Type
  Elongation factors
   DelCs14_0446
 Prokaryotic Type
   DelCs14_0446
Mitochondrial biogenesis [BR:del03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DelCs14_0446
Exosome [BR:del04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DelCs14_0446
  Exosomal proteins of breast cancer cells
   DelCs14_0446
  Exosomal proteins of colorectal cancer cells
   DelCs14_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AEF87486
UniProt: F6AN13
LinkDB All DBs
Position
478009..479199
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETAGRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLAKYDFPGDDTPIIRGSAKLALE
GDQSDKGEPAILRLAEALDSYIPTPERAVDGAFAMPVEDVFSISGRGTVVTGRIERGIIK
VGEEIEIVGIRDTQKTIVTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPADKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcaaaattcgagcgtaccaagccgcacgtcaacgttggcaccatcggtcac
gtggaccacggcaagacgaccctgacggctgctatcgctaccgttctgtccaagaagttc
ggcggcgaagccaaggcttacgaccagatcgacgcagcacctgaagaaaaggctcgcggc
atcacgatcaacaccgcccacgtcgagtacgaaacggccggtcgccactacgctcacgtt
gactgccccggccacgccgactacgtcaagaacatgatcaccggcgctgctcaaatggac
ggcgccatcctggtgtgctcggccgctgacggccccatgccccagacccgcgagcacatc
ctgctggcccgtcaggtgggcgtgccctacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgaagagctgctggaactggtcgaaatggaagtgcgcgagctgcttgccaag
tacgacttccccggcgacgacacccccatcatccgcggctcggccaagctggccctggaa
ggcgaccagtccgacaagggcgaacctgccatcctgcgcctggctgaagcactggactcc
tacatccccacgcccgagcgcgctgtggacggcgcctttgcaatgcccgtggaagacgtg
ttctcgatctctggccgtggcaccgtggtgactggccgtatcgagcgcggcatcatcaag
gtcggcgaagaaatcgaaatcgtcggtatccgcgacacccagaagaccatcgtcaccggc
gtggaaatgttccgcaagctgctggaccaaggtcaagctggcgacaacgtgggtctgctg
ctgcgcggcaccaagcgtgaagacgtggaacgcggccaagtgctgtgcaagcccggctcc
atcaagccccacacccacttcacggctgaggtgtacgtgctgtccaaggacgaaggtggt
cgccacactccgttcttcaacaactaccgtccccagttctatttccgtacgaccgacgtg
accggctccatcgagctgcccgccgacaaggaaatggtgatgcctggcgacaacgtgtcg
atcaccgtcaagctgatcgcccccatcgccatggaagaaggtctgcgcttcgctatccgc
gaaggtggccgtaccgtgggcgctggcgtggttgccaagatcattgcctaa

DBGET integrated database retrieval system