KEGG   Delftia sp. Cs1-4: DelCs14_1541Help
Entry
DelCs14_1541      CDS       T01497                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
del  Delftia sp. Cs1-4
Brite
KEGG Orthology (KO) [BR:del00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DelCs14_1541
Enzymes [BR:del01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DelCs14_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_oxidored GIDA FAD_binding_2 HI0933_like DAO NAD_binding_8 AlaDh_PNT_C FAD_binding_3 Thi4 Glutaredoxin DSBA K_oxygenase Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AEF88573
UniProt: F6AM71
LinkDB All DBs
Position
1740905..1742461
Genome map
AA seq 518 aa AA seqDB search
MLDNNLKAQLQAYLERLQRPVELVASLDDSQGARELKELLLEIRELSDKITVVEHNDAEV
RKPSFLITNPGVDSGVRFAGVPLGHEFTSLVLALLQVGGHPSKESAELLEQVRNIDVPLH
FETYYSLSCHNCPDVVQALNLMSVLNPKISHTAIDGGLFQKEVEQREVMGVPTVFVNGER
FGQGRMELAEIVAKVDTGAASREAAKISAKDAFDVLIVGGGPAGAAAAIYAARKGIRTGI
AAERFGGQVLDTVDIENFISVSKTEGPQLAAAMERHVRDYEVDIMNLQTASKLIPATTEG
GLIEVQTASGASLKAKTVILSTGARWRNMNVPGEDKYRTKGVTYCPHCDGPLFKGKNVAV
IGGGNSGVEAAIDLAGIVRSVTLLEFASELKADAVLQKKLRSLPNVTVILNAQTTEVNGD
GKKVTGLTYKDRTTEELKTVALEGIFVQIGLLPNTDWLKGTVELTRFGEIVIDAKGHTSV
PGVFGAGDCTNVPYKQIIIAAGAGSTAALSAFDHLIRH
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacaacaacctgaaagcccaattgcaggcctacctggagcgcctgcagcgtccg
gtggagctggtggcttcgctggatgacagccagggtgcgcgcgagctgaaggaactgctg
ctggaaatccgcgagctgagcgacaagatcaccgtcgtcgagcacaacgacgccgaggtg
cgcaagccctcgttcttgatcaccaatcccggcgtggacagcggcgtgcgtttcgcaggc
gtccccctgggccatgaattcacctcgctggtgctggccctgctgcaggtcggcggccat
ccgtccaaggaatcggccgagctgctggagcaggtgcgcaatatcgacgtgccgctgcac
ttcgagacctattactcgctgtcctgccacaactgtcccgacgtggtgcaggcgctgaac
ctgatgtccgtgctcaaccccaagatcagccataccgccatcgacggcgggctgttccag
aaggaagtcgagcagcgcgaagtcatgggcgtgcccaccgtctttgtgaacggcgagcgc
ttcggccagggccgcatggagctggccgagatcgtggccaaggtcgataccggcgccgct
tcgcgtgaagcggccaagatttccgccaaggatgccttcgacgtgctgatcgtcggcggc
ggcccggccggcgccgcggctgccatctatgcggcacgcaagggcatccgcaccggcatc
gccgccgagcgcttcggtggtcaggtgctggacaccgtggacatcgagaacttcatctcg
gtctccaagaccgaaggcccgcaactggccgccgccatggagcgccatgtgcgcgactac
gaggtggacatcatgaacctgcagacggcgtccaaactgattccggctaccacggaaggc
gggctgatcgaggtgcagaccgcctcgggcgccagcctcaaggccaagaccgtcatcctc
tcgaccggcgcgcgctggcgcaacatgaacgtgccgggcgaggacaagtaccgcaccaag
ggcgtgacctactgcccgcactgcgacggtcccttgttcaagggcaagaatgtggccgtc
atcggcggcggcaactcgggcgtggaagcggccatcgacctggccggcatcgtgcgcagc
gtgacgctgctggagttcgccagcgagctcaaggccgacgccgtgctgcaaaagaagctg
cgcagcctgcccaacgtcacggtcatcctcaacgcccagaccaccgaggtcaacggcgat
ggcaagaaggtcaccggcctgacctacaaggaccgcacgacggaagagctcaagaccgtg
gcgctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgactggctcaagggc
acggtggagctgacacgcttcggcgagatcgtgatcgacgccaagggccacaccagcgtg
cccggcgtgttcggcgcaggcgactgcaccaatgtgccgtacaagcagatcatcattgct
gccggtgccggctccacggctgcgctgtcggccttcgaccacctgatccgccactga

DBGET integrated database retrieval system