KEGG   Delftia sp. Cs1-4: DelCs14_2013Help
Entry
DelCs14_2013      CDS       T01497                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
del  Delftia sp. Cs1-4
Pathway
del00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:del00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DelCs14_2013
Enzymes [BR:del01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DelCs14_2013
Transporters [BR:del02000]
 Other Transporters
  Pores ion channels [TC:1]
   DelCs14_2013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 DUF1231
Motif
Other DBs
NCBI-ProteinID: AEF89033
UniProt: F6AT16
LinkDB All DBs
Position
complement(2274175..2274795)
Genome map
AA seq 206 aa AA seqDB search
MTTLKLYYAPGTCALATRIALIEANAPHEVIKLDFPKGEQRSPEYLAINPKGRVPALVTE
RGVLTETPALLAYVARRFPEARLAPLDDAYAFAHMQDFHSYLSSTVHVAHAHGRRAGRWA
DDEAAIASMQRKVAANMAECFGVIERHYLGDAPWVLGSDYSVADAYLFTIAGWLEGDGVD
IAGFPKVQAHFKRMGERAAVRGALGN
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctcaagctctactacgcgcccggcacctgcgccctggccacccgcatcgcc
ctgatcgaagccaatgcgccgcacgaagtcatcaagctcgacttccccaagggcgagcag
cgcagccctgaatacctggccatcaatcccaagggccgcgtgcccgccctggtgaccgag
cgcggcgtgctcaccgaaacgccggccctgctggcctacgttgcgcgccgcttccccgag
gcccggctcgccccgctcgacgatgcgtatgcctttgcccacatgcaggatttccacagc
tacctgtcctccaccgtgcacgtggcccacgcccacgggcgccgcgcaggccgctgggcc
gatgacgaagcggccattgcctccatgcagcgcaaggtggcagccaacatggccgaatgc
tttggcgtgatcgagcgccattacctgggcgatgccccctgggtgctgggttcggactat
tccgtggccgacgcctatctgttcaccattgccggctggctggaaggcgacggcgtggac
atcgccggcttccccaaggtgcaggcgcatttcaagcgcatgggcgagcgcgctgccgtg
cgcggggcgctggggaactga

DBGET integrated database retrieval system