KEGG   Delftia sp. Cs1-4: DelCs14_2812Help
Entry
DelCs14_2812      CDS       T01497                                 

Definition
(GenBank) Ribose-5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
del  Delftia sp. Cs1-4
Pathway
del00030  Pentose phosphate pathway
del01100  Metabolic pathways
del01110  Biosynthesis of secondary metabolites
del01120  Microbial metabolism in diverse environments
del01130  Biosynthesis of antibiotics
del01200  Carbon metabolism
del01230  Biosynthesis of amino acids
Module
del_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:del00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DelCs14_2812
Enzymes [BR:del01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     DelCs14_2812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AEF89824
UniProt: F6ANI3
LinkDB All DBs
Position
3169708..3170400
Genome map
AA seq 230 aa AA seqDB search
MTTSAASFSQDELKALVGQAALAYVVPGEIVGVGTGSTVNKFIDALATIKDQIPGAVSSS
VASTERLKALGIKVLDANEVASLSVYIDGADEIDGRGYMVKGGGAALTREKIVAALAERF
VCIADASKRVEVLGDFPLPVEVIPMAAAQIANRFKAMGGRAEIRMKDGVPLVTDNGQHIL
DVRGLKIAEPLAFESDVNQWPGVVTVGVFAHQKASVCLLGTPEGVQTLNY
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatctgctgcctctttttcccaagatgaactcaaagccctggtcgggcaagcc
gctctggcctatgtggtgcccggcgaaatcgtcggcgttggcaccggctccacggtcaac
aagttcatcgatgcactggccaccatcaaggaccagatcccgggcgccgtgtccagttcc
gtggccagcaccgagcgcctgaaggcgctgggcatcaaggtgctggatgccaacgaagtc
gccagcctgtcggtctacatcgacggagccgacgagatcgacggccgcggctacatggtc
aagggcggcggcgccgcgctgacgcgcgagaagatcgtcgctgcgctggccgagcgcttt
gtgtgcattgccgatgcctccaagcgcgtcgaggtactcggagactttccgctgcctgtg
gaggtgattcccatggccgctgcccagattgcgaaccgtttcaaggccatgggtggccgc
gccgagatccgcatgaaggacggcgtacccctggtgacggacaacggccagcacattctt
gatgtgcgcggcctgaagatcgcagagcctctggccttcgagtccgacgtcaaccaatgg
cctggcgtggtgaccgtgggagtgtttgcgcaccagaaggcatcggtctgcctgctgggc
acgcccgagggcgtgcagacgctcaactattga

DBGET integrated database retrieval system