KEGG   Delftia sp. Cs1-4: DelCs14_2875Help
Entry
DelCs14_2875      CDS       T01497                                 

Definition
(GenBank) superoxide dismutase copper/zinc binding protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
del  Delftia sp. Cs1-4
Brite
Enzymes [BR:del01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DelCs14_2875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AEF89886
UniProt: F6API0
LinkDB All DBs
Position
complement(3235934..3236572)
Genome map
AA seq 212 aa AA seqDB search
MPLNASQSSHAATSQPSTPSTAVKLLMAAGMVLALGACGSQPKPPAAASASTPAAVTTAP
ASRNVAMAQLQPTQGSKVSGSLQFTAQADGSVRVQGSVQGLAPNSEHGFHVHEKGDCSSP
DGLSAGGHFNPTGQAHGRFDSSTHHTGDLPSLRSDAQGMASIDFVSRGLALDQGPNSVVG
RGLIVHKDPDDYTTQPTGNSGARLACAVITRG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgaacgcttcccaatccagccacgccgccacttcgcagccctccaccccgtcc
accgccgtgaagctgttgatggctgccggcatggtgctggccctgggcgcctgtggcagc
cagcccaagcctcctgccgcagcctccgcctcgaccccggcagccgtcacgacagcgccc
gcctcccgcaatgtggccatggcccagctgcagcccacgcaaggcagcaaggtcagcggc
agcctgcagttcacggcacaggccgatggcagcgtgcgcgtgcaaggctccgtccagggg
ctggcgccgaacagcgagcacggctttcacgtgcatgaaaaaggcgattgctccagccct
gacggcctgagcgcgggcggccacttcaacccgaccggccaggcccatggccgcttcgat
tcttcgacccatcacacgggcgacctgcccagcctgcgatccgatgcgcaaggcatggca
agcatcgactttgtgtcgcgcggcctggcattggaccagggccccaacagcgtggtgggt
cgtggcctgatcgtgcacaaggacccggacgactacaccacgcaacccaccggcaactcg
ggagcgcgcctggcctgtgcggtgatcacgcgcggatga

DBGET integrated database retrieval system