KEGG   Delftia sp. Cs1-4: DelCs14_3073Help
Entry
DelCs14_3073      CDS       T01497                                 

Definition
(GenBank) transcriptional regulator, MarR family
Organism
del  Delftia sp. Cs1-4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 TrmB HTH_Crp_2 HTH_27 LexA_DNA_bind HTH_24 Penicillinase_R HTH_29 Fe_dep_repress GntR HTH_IclR HTH_34 PadR HxlR DUF4423 PDCD7 HTH_36 Transgly
Motif
Other DBs
NCBI-ProteinID: AEF90077
UniProt: F6ASA9
LinkDB All DBs
Position
3478154..3478690
Genome map
AA seq 178 aa AA seqDB search
MTQPPLPNGLQPSDFYSPGSYTPFESVGFLMRKVLSSILQQADAQLAEHELTYVQWLPLY
KLLLCSDATNAGMARDLGLDPASITRALDRLESKGMLRRERSTVDRRVVKLVLTDEGRAM
AAKVPQVLSSVMNAHMAGFSHDESRQLLDMLRRLLANGDAMRAPEAAPPAPAPATPAA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcctcccctgcccaacggcctgcagccctcggacttctacagcccaggcagc
tacacgcccttcgagagcgtggggttcctcatgcgcaaggtgctcagctccatcctccag
caggccgatgcgcagttggccgagcatgagctgacctatgtgcagtggctgccgctgtac
aagctgctgctgtgcagcgacgccacgaatgccggcatggcgcgtgacctggggctggat
ccggcctccatcacgcgggcgctggaccggctcgaatccaagggcatgctgcggcgcgag
cgctccacggtggaccggcgcgtggtcaagctggtgctgaccgatgaaggccgcgccatg
gcggccaaggtgccgcaggtgctgtccagcgtgatgaatgcccatatggccggcttcagc
catgacgagtcccgccagctgctggacatgctgcgccgcctgctggccaacggcgatgcg
atgcgcgcgccggaggctgcgccgccggcccctgcgcctgccacgcccgcggcctga

DBGET integrated database retrieval system