KEGG   Delftia sp. Cs1-4: DelCs14_3345Help
Entry
DelCs14_3345      CDS       T01497                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer with Cache sensor
  KO
K03406  methyl-accepting chemotaxis protein
Organism
del  Delftia sp. Cs1-4
Pathway
del02020  Two-component system
del02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:del00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DelCs14_3345
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    DelCs14_3345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:del02035]
    DelCs14_3345
Bacterial motility proteins [BR:del02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    DelCs14_3345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal dCache_1 HAMP ISG65-75 DUF1664 Prominin
Motif
Other DBs
NCBI-ProteinID: AEF90340
UniProt: F6AV72
LinkDB All DBs
Position
complement(3782790..3784610)
Genome map
AA seq 606 aa AA seqDB search
MFQTLRARLILICVAITVAALFALSMATFWTARSSTLSDIDENIGQLTRAHASTLTDWVQ
DKQRITGSLKKAVDQPDPIPFLLAGQQAGGFDDAYFVHADKRAVFTHPMPENYDGTQRDW
FKQAVREGRPGVTPAYVDASTGELTISFVDPVGSSGAITAVVGTDVRLAAMSRKVAAIRP
QEKSFAFLIDGEGRLLAYAKPELALKPASAIAPELDAALIKRLAEQGGRADLVLDGEPQM
LYAAKVEGTPWTLAVVIDRAQATDSVRALLQVAALITVLSVLGAAVLLTVALRRMLNRLA
VARDALQDIASGEGDLTRRLTSAGRDELAQIGQSFNQFVDKIATVLLRIRESSESVRMAS
AEIAGGNQDLSSRTEQQASSLEQTAAAMEQITATVQQNAANARQASELATSASQIATQGG
EAVGQVVQTMGGIEASARKIESIIGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVAS
EVRTLAQRSATAAREIKALIDDSVGQIDTGSRLVRNAGTTIDQAVDGVRKLSTLVAEISN
ASQEQSRGIAEVGSAIGQMDQVTQQNAALVEEVTAAAQSLQQQAVQLAQAVAGFKLDEGN
GARRLR
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaacacttcgtgcccgcctgatcctcatctgcgtagcaatcaccgtggccgcg
ctgttcgcgctgtccatggccaccttctggacggcgcgcagcagtacgctgtccgatatc
gacgaaaacatcggccagctcacgcgggcccatgcatccacactgaccgactgggttcag
gacaagcagcgcatcaccggctcattgaagaaggcggtggaccagccggaccccatcccc
ttcctgctggccggccagcaggctggcggcttcgatgacgcctatttcgtccatgccgac
aagcgcgccgtgttcacccatcccatgccggagaactacgacggaacccagcgcgactgg
ttcaagcaggccgtgcgcgaaggccggccgggcgtgacgccggcctatgtcgatgccagc
accggcgagctgaccatcagctttgtcgatccggtcggcagctcgggcgccatcacggcc
gttgtcggcactgatgtgcggttggccgccatgtccaggaaagtggccgccatccgtccc
caggaaaaaagctttgcctttctgattgatggcgaaggccgcttgctggcctacgccaag
cccgagctggcgctcaagcccgcttccgcgattgcccctgaactcgatgccgcgctgatc
aagcgcctggccgagcagggcggccgcgccgatctggtgctcgatggcgaaccgcagatg
ctctacgccgccaaggtcgagggcacgccctggacgctggccgtggtgatcgaccgcgca
caggccacggattcggtgcgggcgctgctgcaggtggccgccctcatcaccgtgctgtcc
gtgctgggcgcggcggtgctgctgaccgtggcgctgcgccgcatgctcaaccgcctggcc
gtggcacgcgatgcgctgcaggacatcgcctcgggcgaaggcgatctgacccgccgcctc
acctctgccggccgcgatgagctggcgcagatcggccagtccttcaaccagttcgtggac
aagatcgccacggtgctgctgcgcattcgcgagtcgtcggaatcggtgcgcatggcgtcg
gcagagattgcgggtggcaaccaggacctgtcgtcacgcaccgagcagcaggccagctcg
ctggagcagacggcagccgccatggagcagatcacggcaaccgtgcagcagaacgcggcc
aatgcgcgccaggccagcgagctggccaccagcgcctcgcagatcgccacccagggcgga
gaggccgtcggccaggtggtgcagaccatgggcggcatcgaggcctcggcccgcaagatc
gaaagcatcatcggcgtgatcgactccattgccttccagaccaacatcctcgcgctgaac
gcggcggtggaagcggcgcgcgccggcgagcagggtcggggctttgccgtggtcgccagc
gaggtgcgcacgctggcgcaacgcagcgccacggcggccagggagatcaaggcgctgatc
gatgattccgtgggccagatcgacacgggaagccgcctggtgcgcaatgcgggcaccacc
atcgaccaggccgtggacggcgtgcgcaagctcagcacgctggtggccgagatcagcaac
gccagccaggagcaaagccgtggcattgccgaggtgggcagcgccatcggccagatggac
caggtcacgcagcagaacgctgccctggtggaggaggtcacggccgcagcgcagtcgctg
cagcagcaggcggtgcagctggcgcaggccgtggcgggcttcaagctcgacgaaggaaac
ggcgcccgccgcctgcgctga

DBGET integrated database retrieval system