KEGG   Delftia sp. Cs1-4: DelCs14_4596Help
Entry
DelCs14_4596      CDS       T01497                                 

Definition
(GenBank) Amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
del  Delftia sp. Cs1-4
Pathway
del00970  Aminoacyl-tRNA biosynthesis
del01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:del00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DelCs14_4596
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:del03029]
    DelCs14_4596
Enzymes [BR:del01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     DelCs14_4596
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     DelCs14_4596
Mitochondrial biogenesis [BR:del03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    DelCs14_4596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Pro_racemase
Motif
Other DBs
NCBI-ProteinID: AEF91572
UniProt: F6ANN2
LinkDB All DBs
Position
5181549..5182982
Genome map
AA seq 477 aa AA seqDB search
MKTDGCQTAPPSASELHAAYAAGTLTPMQATEHCLRVACASQSVFTRITADRALEEARQS
TERWRAGRPLGPLDGIPISWKDLFDVRGTPTTAASALLQSAAPARADATVVARAAAAGMV
CLGKTNLSEFAYSGLGLNPCFGTPVFAHEGGHDRAPGGSSSGAALAVALGCGPLAMGTDT
AGSVRIPAAFNGLVGYRASRGRYCLQGVFALAPSLDALGPLALSVADCMALDRVLRGLTD
DGHANASPAADLRNQVFCTDLSLLDDDRVQAPVRNNLLSSLALLETRGARVERRTLRSLR
AVRTLTRRHGWLGAHEAFATHRARLDDADQAARMDPRVRQRLEAARHLSPDSYRTLIAQR
APLMALFAQELGDATLVLPTTGHTAPLLLPLLDDDRLFAETNLATLRLTMPGSYLDTPAV
ALPSGVQRIPGLDGRPAFLPTGLQLMRPRGDDDRLLRIALSVEQVLSPSTVPIDRSA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgatggctgccagacggcgcctccctcggcctccgaactgcatgcggcgtat
gcagccggcacgctgacgcccatgcaagccacggagcactgcctgcgggttgcctgcgca
agccaatccgtgttcacgcgcatcacggcggaccgcgcgctcgaagaggcccggcagtcc
accgagcgctggcgcgcgggccggccgctggggccgctggacggcatccccatcagctgg
aaggacttgttcgacgtgcgcggcacgccgaccacggcggcctcggccctgctgcagtcg
gccgcgccagcccgggccgacgccaccgtggtggcgcgtgccgcagcggccggcatggtc
tgcctgggcaagaccaatctcagtgagttcgcctactcgggcctggggctcaatccctgc
ttcggcacgccggtgtttgcacatgagggaggccacgaccgggcgcccggaggctcgtcc
agcggcgctgcgctggccgtggccctggggtgcgggccgctggccatgggcacggacacg
gcggggtccgtgcgcattcccgccgccttcaacgggctggtgggctatcgcgccagcagg
gggcgctattgcctgcagggcgtgtttgcgctggcgccgtccctggacgccctggggccg
ctggccctgagcgtggccgactgcatggcgctggaccgcgtgctgcgcgggctgaccgac
gacggccatgccaacgcatcccccgccgcggacctgcgcaatcaggtgttctgcacggac
ctcagcctgctggatgacgaccgcgtgcaagctcccgtgcgcaacaacctcctgtcctcc
ctggccttgctggagacccggggtgcccgcgtggagcgccgcacgctgcgcagcctgcgc
gccgtacggacgctgacccggcgccatggctggctgggcgcccatgaagcctttgccacc
caccgcgcacgcctggacgatgccgatcaggccgcacgcatggacccgcgcgtgcgccag
cgcctggaggcggccaggcatctgagtcctgacagctaccggacattgatcgcccagcgc
gcaccactgatggccttgttcgcgcaggagctgggcgatgccaccctggtgctgcccacc
acgggccacaccgcacccctgctgctgccgctgctggacgacgacaggctgtttgccgaa
accaacctcgccacgctgcggctgaccatgcccggcagctacctggacacgccggccgtg
gccctgcccagcggcgtgcagcgcattcccggcctggacggcaggcctgcgtttctgccc
acgggcctgcagctcatgcgcccccggggcgatgacgaccggctgctgcgcattgcgctg
agcgtcgaacaggttctttccccctccaccgttcccattgataggagtgcatga

DBGET integrated database retrieval system