KEGG   Delftia sp. Cs1-4: DelCs14_5491Help
Entry
DelCs14_5491      CDS       T01497                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
del  Delftia sp. Cs1-4
Pathway
del00564  Glycerophospholipid metabolism
del01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:del00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DelCs14_5491
Enzymes [BR:del01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     DelCs14_5491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 HI0933_like GIDA Lycopene_cycl NAD_binding_8 Thi4 3HCDH_N Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AEF92461
UniProt: F6B1A8
LinkDB All DBs
Position
complement(6181813..6183402)
Genome map
AA seq 529 aa AA seqDB search
MSLAASPLPTGRAALLERLAQPETYDLAIIGGGATGLGVALDAAARGFKVVLVESHDFAK
GTSSRATKLVHGGVRYLAQGNIALVREALHERTTLLHNAPHLAQPLAFVMPSYKLLDTPF
YGIGLKMYDALAGKAGLGATEFLSRSSTVKCLPTVRQQGLKGGVKYWDGQFDDARLALAL
ARTAAAKGALLVNYCPALELLHEGGKVAGLVCEDTESGRRFTLRAKCVVNATGPWVDLFR
QQDAEAQGRPVKPMVAPSQGVHVVVDRDFLPSDHALLVPKTADGRVLFAVPWLGKVILGT
TDTPRNDLAREPLPFPEELDFILTEAGRYLTRQPTLADVRSMWVGLRPLVKPQDDDGENT
KKISREHTVMSSRTGLVTVTGGKWTTYRAMAEDVLSECFAIGRLPHRPGGVTARLPLAGA
PAESAVHHRMNQVQGLHSYGTEASAVEALPGNDEWLADGLNEAMVRFAARFEYARTVEDV
LARRSRLLFLDARKAAEVAPRVAAILQEELGQDAGLADFMPLAAQYLPA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcgctgcttcccctctgcccactggccgcgccgccctgctggaacgcctggcc
cagcctgaaacctacgatctggccatcatcggcggcggtgccaccggcctgggcgtggcc
ctggacgcggcggcgcgcggcttcaaggtcgtgctggtggagtcgcatgacttcgccaag
ggcacgtcctcgcgtgccaccaaactggtccatggtggcgtgcgctacctggcccagggc
aacatcgccctggtgcgcgaagcgctgcacgagcgcaccacgctgctgcacaacgcgccc
cacctggcgcagccactggcctttgtcatgccgtcctacaagctgctggacacgccgttc
tacggcatcggcctcaagatgtatgacgcgctggccggcaaggcgggcctgggcgctacg
gagttcctctcgcgctccagcaccgtcaagtgtttgcccaccgtgcgccagcaaggcctc
aagggcggcgtcaaatactgggacggccagttcgacgatgcccgcctggcgctggcgctg
gcacgcacggccgctgccaagggcgcgctgctggtcaactactgccccgcgcttgagctg
ctgcatgaaggcggcaaggtcgccggcctggtctgcgaagacacggaatcgggccggcgc
ttcacgctgcgcgccaagtgcgtggtcaacgccaccggcccctgggtggacctgttccgc
cagcaggatgccgaggcccagggccgtcccgtcaagcccatggtcgcgcccagccagggc
gtgcacgtggtggtggaccgcgacttcctgcccagcgatcacgccctgctcgtgccgaag
acggccgatggccgcgtgctctttgccgtgccctggctgggcaaggtcatcctgggcacc
accgacaccccgcgcaatgacctggcacgcgagcccctgccgttccccgaggagctggac
ttcatcctcaccgaggccggacgctacctcacgcgccagcccacgctggccgacgtgcgc
agcatgtgggtcggcctgcgcccgctggtcaagccccaggacgacgacggcgagaacacc
aagaagatcagccgcgagcacacggtcatgtccagccgcaccggcttggtcaccgtcacg
ggcggcaaatggaccacctaccgcgccatggccgaagacgtgctctccgagtgctttgcc
atcggccgcctgccgcaccgccccggcggcgtcacggcccgcctgccgctggccggtgct
ccggccgagtccgccgtgcaccaccgcatgaaccaggtccagggcctgcactcctatggc
acggaagcctcggcggtggaggcgttgccgggcaacgacgaatggctggcagacggcctg
aacgaagccatggtgcgctttgccgcgcgcttcgaatacgcgcgcaccgtggaagacgtg
ctggcgcgccgcagccgcctgctgttcctcgatgcgcgcaaggccgccgaggtggcgccg
cgcgtggcagccatcctccaggaggagctggggcaggacgccggcctggcggacttcatg
ccgctggcggcccagtacctgccggcctga

DBGET integrated database retrieval system