KEGG   Candidatus Doolittlea endobia: MHIR_DE00156Help
Entry
MHIR_DE00156      CDS       T04480                                 

Gene name
galP
Definition
(GenBank) Galactose-proton symporter
  KO
K08137  MFS transporter, SP family, galactose:H+ symporter
Organism
den  Candidatus Doolittlea endobia
Brite
KEGG Orthology (KO) [BR:den00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:den02000]
    MHIR_DE00156 (galP)
Transporters [BR:den02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    MHIR_DE00156 (galP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_2 TraD MFS_4 PglL_A
Motif
Other DBs
NCBI-ProteinID: CUX96491
UniProt: A0A143WSB4
LinkDB All DBs
Position
I:178409..179806
Genome map
AA seq 465 aa AA seqDB search
MSTATRQPGRSHARLTFFVCFMAALAGLLFGLDIGVIAGALPFLSSDLQSDNRQQEWIVS
SMMFGAAVGAVAAGWMSAKRGRKFSLLISSVLFIIGSLWSALSPNVESIIIARILLGLAV
GIASYTAPLYLSEIASESIRGSMISMYQLMITIGILAAYLSDTAFSYSGSWRWMLGVITI
PAVLMFIGVLFLPGSPRWLAARGRYHEAQKVLNMLRSSSEQVRKELDEIHESLKIKQSGW
ALFKNNPNFRRAVFLGVLLQVMQQFTGINVIMYYAPKIFGIAGFASTTNQMWGTVIVGLV
NVLATFIAIGLVDRWGRKPTLKLGFLVMALGMGVLGTLLHLGVDTDFRKYFSIVMLMLFI
VGFAMSAGPLIWVLCSEIQPLKGRDFGITVSTATNWIANMIVGATFLTMLETLGNASTFW
IYGALNVLFIVLTIMLIPETKNVSLEHIERNLMTGKLLREIGARD
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgccacacgtcaacccggtaggtcacatgctcgtttgactttttttgtttgt
tttatggccgcgttggctggcctattatttggattggatattggcgttattgccggcgca
ttaccttttttatcttcggatttgcaaagcgataatcgccaacaagaatggatagtcagc
tctatgatgtttggcgccgcagtgggcgcagtcgccgcaggctggatgtcagctaagcgg
gggaggaaattcagcttacttattagtagcgttttatttattatcggctcgttatggtca
gcgttatcccccaatgtggaatccattatcatcgcacgtattttattgggtctagcagtc
gggattgcctcttacactgcgccgctttatttatcggaaattgcatcggaaagcatccgc
ggctcgatgatttctatgtatcagttaatgatcactattggaattttagcggcttatttg
tctgataccgctttcagctatagcggatcttggcgatggatgctaggagtcattactatc
ccagcagtgctgatgtttatcggtgtcctgtttttgccgggaagtccacgctggcttgcg
gcacgaggacgttaccatgaagcacagaaagtactgaatatgttgcgaagctccagcgag
caagtacgtaaggagcttgatgaaatccacgaaagtttgaaaattaaacaaagtggttgg
gcattatttaaaaataaccctaatttccgccgcgcggtattcctcggcgttttattacag
gtgatgcagcaatttactggtataaatgtaattatgtattatgcgccaaaaatttttggt
attgctggctttgccagtaccaccaaccagatgtggggaacggtgattgtcggattggtc
aacgtacttgcgacgtttatagctatcgggttggtagatcgctggggccgaaaaccgacg
ctgaagctcggttttcttgtaatggcgctcggtatgggcgtgttaggtacacttctccat
ctaggcgtcgacaccgactttcgaaaatatttttcgattgtcatgttaatgttatttatc
gttggttttgccatgagcgccggcccgctgatttgggtattgtgttccgaaatacagcca
ctgaaaggacgcgattttggtataaccgtttctaccgctactaattggattgctaatatg
atagtcggtgctacttttttgaccatgttagaaacactaggcaatgccagcactttctgg
atctatggcgcattgaatgttctgttcatcgtattgactattatgctgattccagaaacc
aaaaacgtttctcttgaacatattgaacgtaacctgatgacaggcaaactgctacgcgaa
atcggcgcgcgggactaa

DBGET integrated database retrieval system