KEGG   Desulfobulbus oralis: CAY53_10315Help
Entry
CAY53_10315       CDS       T05339                                 

Definition
(GenBank) beta-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
deo  Desulfobulbus oralis
Pathway
deo00061  Fatty acid biosynthesis
deo00780  Biotin metabolism
deo01100  Metabolic pathways
deo01212  Fatty acid metabolism
Module
deo_M00083  Fatty acid biosynthesis, elongation
deo_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:deo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CAY53_10315
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CAY53_10315
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:deo01004]
    CAY53_10315
Enzymes [BR:deo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CAY53_10315
Lipid biosynthesis proteins [BR:deo01004]
 Fatty acid synthase
  Component type
   CAY53_10315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA 4HBT S4
Motif
Other DBs
NCBI-ProteinID: AVD71808
UniProt: A0A2L1GQ86
LinkDB All DBs
Position
complement(2347131..2347580)
Genome map
AA seq 149 aa AA seqDB search
MMELAFIEARIPHRPPFLWLDRVLELSDTAIRAEKHVPGDLPLFQGHYPGYPLVPGVLLC
EAVFQAGALLLAERLRQTGAAAGGHKGGVPVLTRIFGAKFKREVHPGDTLAIGAELTERL
AQAWLMKGTVRVDGKLAAQVEFACAGKEM
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgatggaactggcctttatcgaagcgcgtattccgcaccggccgccctttctctggctc
gaccgggtgctggagctgagcgatacggccatccgcgcggaaaagcatgtgcctggagat
ctgccgctcttccaggggcactatcccggttatccgctcgtgcctggggtgttgctctgc
gaggcggtttttcaggccggagcgctcctgcttgccgaaagactgcggcagaccggagcc
gcggcaggcggccacaagggcggcgtgccggttctgacccgtatctttggcgccaaattc
aagcgggaggtgcatcccggcgacacgctggcaatcggtgccgaactgacggagcgcttg
gcccaggcctggctgatgaaaggcacggtgcgtgtggacggcaaactggcagcgcaggtg
gaattcgcctgcgccggcaaggagatgtga

DBGET integrated database retrieval system