KEGG   Devosia sp. H5989: XM25_00220Help
Entry
XM25_00220        CDS       T04003                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
deq  Devosia sp. H5989
Pathway
deq00500  Starch and sucrose metabolism
deq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XM25_00220
Enzymes [BR:deq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     XM25_00220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: AKR54253
UniProt: A0A0K0TR80
LinkDB All DBs
Position
complement(39597..41888)
Genome map
AA seq 763 aa AA seqDB search
MGDTRNEPPGKPGINPTWSSSAKDMVSTALGASRLWATFGYGIVNEVYWPSTGQPQIRDL
GFIIAGPDGWTEVKRAQRYSISMPKPYVPLPRVVHRGDNYRLELEYLVHPLRDALLIRYK
LDGDDLKLYSLISPHLNGERHDNTAWAGEDLSAQLGYAALCLRNDSGFSRASAGYVGFSD
GWQDFDKNGKMTWTYPEAGEGNVALMGELAANSGTLALCFAETVEGARTLARSSLADDYD
DVVRIFTGQWEDWGRTLDIPHASPEIKREAQLSAAVIKIHEDRTYAGAMVASLSVPWGSS
HDDLGGYHLVWTRDAVEAAFAMIAVGQLTDAARTLAYLVGTQAEDGSWAQNYFPDGQGYW
EGKQLDEVALPVLLMAKLRAVGHLTIARPIETMVEKAVGFMVRNGPMTDQDRWEENSGAS
PFTLTATICALVAAADLMAPEERDYVLSLADCWNERIEDWTYTTGGPLCAPHGVDGYYVR
IAPRSDQKGLRGVVEIRNVGGEETAAADLVGLEFLTLVRSGLRAADDPGILNTVKIIDAV
LRRETPSGPSYHRYNGDGYGEHADGSPYDGKGIGRLWPLLTGERGHFAISADGDARPYLD
AMSRMTGPGGLLPEQIWDSDPIPERGLWPGKPSGSAMPLIWAHAEFLKLLAAQADGRPSE
ALAVVEQRYGGKRPTAAQWHWRENSPFDALPAGRALLIERGAPFILRYRLADGAQPREKP
SAPTQLGMHGVLFAPADLPAGATLSFSFADDASEGGDLTIALG
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacacccgcaacgagccacccggcaagccgggcatcaatccgacctggtcatcg
agcgccaaggacatggtgagcacggcgctgggcgccagccggctgtgggcgacgttcggc
tacggcatcgtcaacgaggtctattggccctcgaccggccagccgcagatccgggacctg
ggcttcatcatcgcggggccggacggctggaccgaggtcaagcgggcgcagcgctattcg
atctcgatgcccaaaccctatgtgccgctgccgcgcgtggtgcaccggggcgacaactac
cggctcgaactcgaatacctggtgcatccgctgcgcgatgcgctactcatccgctacaag
ctcgatggcgacgacctcaagctctacagcctcatctcgccgcacctgaacggcgagcgg
catgacaataccgcctgggccggggaggacctttcggcccagctcggctacgcggccctg
tgcctgcgcaacgacagcggcttctcgcgcgccagcgcgggctatgttgggttctcggac
ggctggcaggatttcgacaagaacggcaagatgacctggacctaccccgaggccggggaa
ggcaatgtggcgctgatgggcgaactggcggccaacagcggcacgctggcgctctgtttc
gccgaaacggtggagggcgcgcgcacgctggcgcgctcgagcctcgcggacgactacgac
gacgtggtccgcatctttaccgggcaatgggaggactgggggcgcacgctcgacattccc
catgcctcccccgagatcaagcgcgaggcgcaactgtccgctgccgtcatcaagatccac
gaggatcgcacctatgccggggccatggtggcaagcctgagcgtaccctggggcagcagc
catgacgatttgggcggctatcacctggtgtggacgcgcgacgcggtcgaggcggcattc
gccatgatcgcggtagggcaactgaccgatgcggcgcgcacgctcgcctacctcgtcggc
acccaggccgaggacggaagctgggcgcagaactactttccggacggacagggctattgg
gagggcaagcagctcgacgaggtagccctgccggtgctgctgatggcaaagttgcgcgcc
gtgggtcacctcaccattgcccggcccatcgaaacgatggtggagaaggcggtcggcttc
atggtgcgcaacgggccgatgaccgaccaggaccgctgggaggaaaattcgggcgccagt
cccttcacgctgacggcgacgatctgcgcgctggtggcggcggccgacctgatggcgccg
gaggagcgagactacgtgctctcgctcgccgattgctggaacgagcgcatcgaggactgg
acctatacgaccggcgggccgctgtgcgcgccgcacggggtggacggctattacgtgcgc
atcgcgccgcgctcggaccagaaagggctgcgcggggtggtcgaaatccgcaatgtcggc
ggcgaagagaccgcggcggcggatctggtcgggctcgaattcctcacgctcgtgcgcagc
gggctgcgggcggcggacgatccgggcatcctcaacacggtcaagatcatcgatgccgtg
ctgcggcgcgaaacgccgagcggcccctcctaccatcgctataacggggacggctatggc
gagcatgccgatggcagcccctatgacggcaagggcatcgggcggctctggccgctgctg
accggggagcgcggacatttcgccatttccgccgatggcgatgcgcggccctatctcgac
gccatgtcgcgcatgaccggaccgggcggattgctgcccgagcagatctgggacagcgac
cccattccggagcgcgggctctggccgggcaagccatcgggcagcgccatgccgctgatc
tgggcgcatgccgagttcctcaagctgctcgccgctcaggccgatggccgcccctccgag
gcactggcggtggtcgagcagcgttatggcggcaagcgcccgaccgccgcgcaatggcat
tggcgcgagaacagcccgttcgacgccctgcccgccgggcgcgccctgctgatcgaacgc
ggcgccccgttcatcctccgctaccggctggccgatggggcgcagccgcgcgaaaagccc
tccgcgccgacgcagctggggatgcatggggtgctgttcgcccccgccgacctgccggcc
ggggccacgctttccttctcgtttgcggacgacgcaagcgagggcggcgatctcaccatt
gccctgggatga

DBGET integrated database retrieval system