KEGG   Devosia sp. H5989: XM25_00385Help
Entry
XM25_00385        CDS       T04003                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
deq  Devosia sp. H5989
Pathway
deq00564  Glycerophospholipid metabolism
deq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    XM25_00385
Enzymes [BR:deq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     XM25_00385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 Pyr_redox_2 FAD_oxidored DUF2914
Motif
Other DBs
NCBI-ProteinID: AKR54286
UniProt: A0A0K0TRD9
LinkDB All DBs
Position
complement(79458..80984)
Genome map
AA seq 508 aa AA seqDB search
MSEAGNEPGIHDIFVIGGGINGTGVARDAVGRGYSVMLAEMNDLASGTSSAATKLIHGGL
RYLEHYEFRLVHEALTEREVLWAAAPHIIRPLRFVLPYQKGLRPAFVLRTGLFMYDYMGG
RKLLPPTRTLDLRTDEAGKPLKPGYKTAFEYSDCWVDDARFVALNALDARERGAEIRTRT
KVTSARRSQGAWTIDIEDIDTGVREAVRARLLVNAAGPWVDHVIVEAMGNNGAHNVRLVK
GSHIVIRKKFEHDRCYFFQNPDGRIIFAIPYEREFTLIGTTDQDYKADPAKVKISEEETD
YLCKAASEYFKEPVRREDIVWTYSGVRPLFDDGASAAQEATRDYVLKVEGDVATGAVVNV
FGGKLTTSRRLAESVLEKIEGVLGKRGEPWTKSAKLPGGEFEPLAFDAEVEKLKRDYPAL
PAALLRRLMRHYGTRARFILNEASSVAELGEMFGADLSAREVDYLMEEEWAVSAEDVLWR
RSKLGLIVTEDEKARLAAYMAKRLATRI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggcgggtaacgagccggggatccacgatattttcgtcatcggcggtggcatc
aacggcaccggggtggcgcgtgacgcggtgggccgcggctattcggtgatgctggccgaa
atgaacgatctggcctcgggcacgtcatcggcggcgaccaagctcatccatggcgggttg
cgctatctcgagcactacgagttccgcctcgtccacgaggcgctgaccgagcgggaagtc
ctgtgggccgccgcgccgcacatcattcgaccgctgcggttcgtgttgccctaccagaag
ggcctgcgcccggccttcgtgctgcgcacgggcctgttcatgtacgactatatgggtggc
cgcaagctcctgcccccgacccgcacgctggacctgcgcaccgacgaggccggcaagccg
ctcaagccgggctacaagacggcgttcgaatattccgactgctgggtggacgatgcgcgg
ttcgtggcgctcaatgcgctcgacgcccgcgaacggggcgcggaaatccgcacgcgcacc
aaggtcacgtcggcccgccgcagccagggcgcctggaccatcgatatcgaggacatcgat
accggcgtgcgcgaagccgtacgggccaggctcctcgtcaatgccgccggcccttgggtt
gaccacgtgatcgtggaagcgatgggcaataacggggcgcacaacgtgcggctggtcaaa
ggcagccatatcgtcatccgcaagaagttcgagcatgaccgctgctacttcttccagaac
ccggatggccgcatcatcttcgccatcccctatgagcgcgagttcacgctcatcggcacc
accgaccaggactacaaggcggaccctgccaaggtgaagatctccgaggaggagaccgac
tacctctgcaaggcggcgagcgaatatttcaaggagccggtgcggcgcgaggatatcgtc
tggacctattcgggcgtgcgcccgctctttgacgacggcgccagcgccgcccaggaggcg
acgcgcgactacgtgctcaaggtcgagggcgatgtggcgacaggggcggtcgtcaacgtc
ttcggcggcaagctcactacctcgcgccggctggcggagtcggtgctcgagaagatcgag
ggcgtcctcggcaagcgtggcgaaccgtggacgaaatcggccaagctgccgggtggcgag
ttcgagccgctggcattcgatgcggaagtcgaaaagctcaagcgcgactaccctgccctg
cccgcggcgctcctcaggcgcctgatgcggcactacggtacacgggcccgcttcatcctg
aacgaagcctcgtccgtcgccgagcttggcgagatgttcggagcggacctttcggcccgc
gaggtcgactacctcatggaggaggagtgggcggtctcggcggaggacgtcttgtggcgt
cgctccaaactcggcctgattgttacagaggatgagaaggcgcggctggcagcctacatg
gccaagcgcctcgcgacgcgcatttaa

DBGET integrated database retrieval system