KEGG   Devosia sp. H5989: XM25_02990Help
Entry
XM25_02990        CDS       T04003                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
deq  Devosia sp. H5989
Pathway
deq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    XM25_02990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:deq02000]
    XM25_02990
Enzymes [BR:deq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XM25_02990
Transporters [BR:deq02000]
 Other Transporters
  Pores ion channels [TC:1]
   XM25_02990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C Glutaredoxin GST_C_2 GST_C_3 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: AKR54782
UniProt: A0A0K0TSQ6
LinkDB All DBs
Position
600211..600885
Genome map
AA seq 224 aa AA seqDB search
MAKLTLISFPTCPYVQRAIIALKEKQVDFDVVYIDLANKPDWFLAISPLGKVPVLKVEQD
DGRQGIIFESAVILEYLEEAAPGARLHPADPLERAQHRAWMEFGSQVLGDIWKLSAAKTD
EELAAAERALDGKFVRLEDTVAGPYFAGQEFSYVDTVFAPAFRQIDAIESVSPTGLLDAF
PTLSVWRKALRERASVRDAVPANFVDLYLERLRKNEAVVLRKAA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcttacgctcatcagcttccccacctgtccatacgtccaacgggccattatc
gcgctcaaggaaaagcaggtcgatttcgatgtcgtctatatcgaccttgccaacaagccg
gactggttcctggccatctccccgctcggcaaggtgcctgtgctcaaggtggagcaggac
gatgggcgccagggcatcatctttgagagcgctgtcattctcgaatatctcgaggaagct
gcaccgggcgcgagactgcacccggccgatcccctcgagcgcgcgcagcatcgcgcctgg
atggagttcggctcgcaggtcctgggcgacatctggaagctgagcgctgccaagacagac
gaagaactcgcggcggccgagcgcgcgctggatggaaagttcgttcgtctggaggacacc
gtggctggcccctatttcgccgggcaggagttcagctacgtcgacaccgtcttcgccccg
gccttccgtcagatcgacgcaatcgagtcggtgtcccccaccggtctgctcgatgccttc
ccgacgctgagcgtctggcgcaaggcgttgcgcgagcgcgcgagcgttcgcgatgccgtc
ccggccaatttcgtcgatctctaccttgagcgcctcaggaaaaacgaggccgtggtcctc
cgcaaggccgcctga

DBGET integrated database retrieval system