KEGG   Devosia sp. H5989: XM25_03245Help
Entry
XM25_03245        CDS       T04003                                 

Gene name
rbcL
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
deq  Devosia sp. H5989
Pathway
deq00630  Glyoxylate and dicarboxylate metabolism
deq01100  Metabolic pathways
deq01120  Microbial metabolism in diverse environments
deq01200  Carbon metabolism
Module
deq_M00165  Reductive pentose phosphate cycle (Calvin cycle)
deq_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XM25_03245 (rbcL)
Enzymes [BR:deq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     XM25_03245 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKR54831
UniProt: A0A0K0TT69
LinkDB All DBs
Position
656376..657836
Genome map
AA seq 486 aa AA seqDB search
MDTAAKTVRGKDRYKSGVMEYRKMGYWEPDYEPKDTDVIALFRITPQDGVDPIEAAAAVA
GESSTATWTVVWTDRLTATEKYRAKAYRVDEVPNAPGQYFAYIAYDLDLFEPGSIANLSA
SIIGNVFGFKPLKALRLEDMRFPVAYVKTFQGPATGIVVERERLDKFGRPLLGATVKPKL
GLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRDRFLYCMEAVNKAEAATGEIKGT
YLNVTAGDMEAMYERAEFAKELGSCIVMIDLVIGYTAIQSMAKWARKNDMILHLHRAGHG
TYTRQKSHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNTTRGYYDICREGFNPMRLE
HGVFFDQDWASLNKLMPVASGGIHAGQMHQLIHLLGEDTILQFGGGTIGHPMGIQAGATA
NRVALEAMIYARNSGRDYLAEGPQILQEAARHCLPLKQALDTWGDVTFDYTSTDSPDFVP
VATAAE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggataccgccgcaaagaccgtcaggggcaaggaccgctacaagtccggcgtcatggaa
taccggaagatgggctattgggagcccgattacgagccgaaggacaccgacgtcatcgcg
ctcttccgcatcaccccgcaggatggcgtcgaccccatcgaagccgccgccgccgtcgcc
ggtgaatcctccaccgctacctggaccgtcgtctggaccgaccgcctgaccgcgaccgag
aagtatcgcgccaaggcctatcgcgtggacgaagttcccaacgcccccggccagtacttc
gcctatatcgcctacgatctcgatctcttcgagcccggctcgatcgccaacctatcggct
tcgatcatcggcaacgtcttcggcttcaagccgctcaaggccctgcgcctcgaggacatg
cgtttccccgtcgcctatgtgaagactttccagggcccagcgaccggcatcgtcgtcgag
cgcgaacgcctcgacaagttcggccgcccgctcctcggcgccaccgtcaagcccaagctc
ggcctctccgggcgcaattacggccgcgtcgtctacgaggcgctcaagggcggcctcgat
ttcaccaaggacgacgagaacatcaacagccagccgttcatgcactggcgcgaccgcttc
ctctactgcatggaagccgtcaacaaggccgaggccgccaccggcgagatcaagggcacc
tacctcaacgtcaccgccggcgacatggaggccatgtacgagcgcgccgagttcgccaag
gaactgggctcctgcatcgtcatgatcgatctggtgatcggctacacggccatccagtcg
atggccaagtgggcgcgcaagaacgacatgatcctgcacctccaccgcgccggccacggc
acctacacgcgccagaagagccacggcgtctccttccgcgtcatcgccaagtggatgcgc
ctggccggtgtcgaccacatccacgccggcaccgtcgtcggcaagctcgaaggcgatccg
aacaccaccaggggctactacgacatctgccgcgagggctttaaccccatgcgcctcgaa
cacggcgtcttcttcgaccaggattgggcgagcctcaacaagctcatgcccgtggcctcg
ggcggcatccatgccggccagatgcaccaactcatccacctcctcggcgaagacacgatc
ctccagttcggcggcggcaccatcggtcacccgatgggcatccaggccggcgccaccgcc
aaccgcgtcgctctcgaagccatgatctacgcccgcaattccggccgcgactacctggcc
gaaggcccgcagatcctccaggaagccgcccgccactgcctgcccttgaagcaggccctc
gatacctggggcgacgtcaccttcgactacacctcgacggactcgcccgatttcgtgccc
gtcgccacggccgccgaataa

DBGET integrated database retrieval system