KEGG   Devosia sp. H5989: XM25_03250Help
Entry
XM25_03250        CDS       T04003                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
deq  Devosia sp. H5989
Pathway
deq00630  Glyoxylate and dicarboxylate metabolism
deq01100  Metabolic pathways
deq01120  Microbial metabolism in diverse environments
deq01200  Carbon metabolism
Module
deq_M00165  Reductive pentose phosphate cycle (Calvin cycle)
deq_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    XM25_03250
Enzymes [BR:deq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     XM25_03250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small CBM_11 P3A
Motif
Other DBs
NCBI-ProteinID: AKR54832
UniProt: A0A0K0TSW0
LinkDB All DBs
Position
657850..658269
Genome map
AA seq 139 aa AA seqDB search
MRVTQGTFSFLPDFNDDQIRTQVQYCIDNGWAVNIEFTDDPHPRNTYWEMWGLPMFDVAD
AAAIMLELESCRKVHDGKYIRLSAFDASHGWESIRISFIVNRPKEEPGFHLERDNGPGRQ
QHYHLRSYATDKPSGERYL
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttacccaaggcacgttctctttcctgcccgacttcaacgacgaccagattcgc
acgcaggtccaatactgcatcgacaacggctgggccgtgaacatcgagttcaccgacgat
ccgcacccccgcaatacttactgggaaatgtggggcctgccgatgttcgacgtcgccgac
gccgcggccatcatgctcgagctcgagtcctgccgtaaggtccacgacggtaagtacatc
cgcctctcggccttcgacgcttcgcacggctgggagtcgatccgcatctccttcatcgtc
aatcgcccgaaggaagagcccggcttccacctcgaacgcgacaacggccccggccgccag
cagcactaccacctgcgcagctacgccaccgacaagccgtccggcgaacgctacctctga

DBGET integrated database retrieval system