KEGG   Devosia sp. H5989: XM25_05460Help
Entry
XM25_05460        CDS       T04003                                 

Definition
(GenBank) Uracil-DNA glycosylase, family 5
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
deq  Devosia sp. H5989
Pathway
deq03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:deq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    XM25_05460
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:deq03400]
    XM25_05460
Enzymes [BR:deq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     XM25_05460
DNA repair and recombination proteins [BR:deq03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     XM25_05460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG DUF4918
Motif
Other DBs
NCBI-ProteinID: AKR55262
UniProt: A0A0K0TU03
LinkDB All DBs
Position
complement(1158695..1159333)
Genome map
AA seq 212 aa AA seqDB search
MPETNPPHDCQLCPRLAEFRHANRALYPDFFNAPVPNWGDEHPRLIIVGLAPGLKGANKT
GRPFTGDYAGDLLYATLKKVGLASGEFEARADDSLRLEQVLIVNGVRCVPPQNKPTGPEI
ANCRRFLSATLDHYETSVAYVALGRIAHDTLLTTLHERRAAFPFAHGAEHELSSGRRLFD
SYHCSRYNTNTGVLTPEMFEDVIGRAAAFVRG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaaaccaatcccccgcacgattgccagctttgcccgcgcctcgccgaattccgg
catgcgaaccgggcgctctaccctgatttcttcaacgcgccggtgccgaactggggcgac
gagcacccgcggctgatcattgtggggctggcgccgggtctcaagggcgccaacaagacc
ggaaggcctttcacgggcgactatgccggggacctgctctacgccaccttgaagaaggtc
ggccttgcgagcggggaattcgaagcgcgtgccgatgacagcctcaggctcgaacaggtg
ctgatcgtgaacggagtgcgttgcgttccgccgcagaacaagccgaccggccccgagatc
gccaattgccggcggttcctctcggcaacgctcgatcactacgaaaccagcgtcgcctat
gttgccttgggccggatcgcgcatgacacgctgctgacgacgctgcatgaacgacgcgcg
gcctttccgttcgcgcatggcgccgagcacgagttgtccagcggccggcggctcttcgac
agctaccattgctcgcgttacaacacgaataccggcgtcctgacgccggagatgttcgag
gatgtaatcggccgggcggcggccttcgtcagaggctga

DBGET integrated database retrieval system