KEGG   Devosia sp. H5989: XM25_18310Help
Entry
XM25_18310        CDS       T04003                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabA form
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
deq  Devosia sp. H5989
Pathway
deq00061  Fatty acid biosynthesis
deq01100  Metabolic pathways
deq01212  Fatty acid metabolism
Module
deq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    XM25_18310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:deq01004]
    XM25_18310
Enzymes [BR:deq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     XM25_18310
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     XM25_18310
Lipid biosynthesis proteins [BR:deq01004]
 Fatty acid synthase
  Component type
   XM25_18310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AKR57700
UniProt: A0A0K0U125
LinkDB All DBs
Position
3718381..3718887
Genome map
AA seq 168 aa AA seqDB search
MADRPNAYGYEELLACGRGELFGPGNAQLPLPPMLMFDRITHIDETEGAHHRGQVRAELD
VNPDLWFFACHFQGDPVMPGCLGLDALWQMTGFFLGWGGSPGRGRALGGEIKFTGQVTND
VKLVEYGIDIKRVMRSKLALGIADGWVKADGKVIYEAKDLRVGLFTDI
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccgcccgaacgcatacggatacgaagaactgctggcctgcgggcgcggagag
cttttcggaccgggcaatgcgcaattgccgctcccgcccatgctcatgttcgatcgcatt
acccatatcgacgagaccgaaggcgcccatcatcgcggacaggtgcgcgccgaactcgac
gtcaatcccgacctctggttctttgcctgccatttccagggcgatccggtcatgcccggt
tgccttggcctggatgcgctctggcagatgacgggtttcttcctgggctggggcgggtcc
ccgggccgtggtcgcgccctgggcggcgagatcaagttcacgggccaggtgaccaacgac
gtcaagctggttgagtatggtatcgatatcaagcgcgtgatgcgctccaagctagcgctt
ggcattgccgatggctgggtcaaggccgatggcaaggtgatctatgaggccaaggacctg
cgcgtcggccttttcaccgacatttga

DBGET integrated database retrieval system