KEGG   Devosia sp. H5989: XM25_22380Help
Entry
XM25_22380        CDS       T04003                                 

Definition
(GenBank) O-succinylhomoserine sulfhydrylase
  KO
K10764  O-succinylhomoserine sulfhydrylase [EC:2.5.1.-]
Organism
deq  Devosia sp. H5989
Pathway
deq00270  Cysteine and methionine metabolism
deq00920  Sulfur metabolism
deq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:deq00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    XM25_22380
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XM25_22380
Enzymes [BR:deq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.-  
     XM25_22380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 Met_gamma_lyase Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AKR58491
UniProt: A0A0K0U3J3
LinkDB All DBs
Position
complement(4570422..4571627)
Genome map
AA seq 401 aa AA seqDB search
MTKQNNPLFDPKNRSAETSLVHGGIERSQFNETSEPIFMTSGYTYPESAYAEKLFKGEIV
GHNYSRFSNPTVDVLQKRMALLEGAEDARALATGMAAVTCAVQSQVRAGDHIVASRALFG
GCRFVVEDFMPRWGVSSTLVDGRDPENFLKAMRPNTKLIFIETPTNPTLELVDIEAVAKI
AHAGGAKLIVDNVFATALYQSPLKLGADLVTYSATKHIDGQGRALGGLILGSKELITGDV
HTFIRQTGPSISPFNAWMMLKGLETLPLRVRQMTENATRIADFLGDHPKVNRVIYPHHKS
HPQYELAKRQMKAGSTLVAFEVKGGQEAAFKLADSLAVILISNNLGDAKSIITHPRTTTH
QRLTEEVRLESGITPGMLRISVGLENADDLIADLGYGLDQI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcagaacaacccccttttcgaccccaagaaccgctcggcggaaacctcgctg
gtgcatggcggcatcgagcgcagccagttcaacgagacatcagagcccatcttcatgacg
tccgggtacacgtatccggaatccgcctatgccgagaagctcttcaagggcgagatcgtc
gggcacaattattcgcgtttctccaacccgaccgtggacgtgctccagaagcgcatggcg
ctgctcgaaggcgccgaggatgcgcgcgcgctggcgacgggcatggccgcggtgacctgc
gcggtgcagagccaggtgcgggccggcgaccatatcgtggcctcgcgcgcgctgttcggc
ggctgccggttcgtggtggaagacttcatgccgcgctggggcgtgagctcgacgctggtc
gacgggcgtgatcccgagaacttcctcaaggcgatgcggcccaataccaagctcatcttc
atcgagacgccgaccaacccgacgctggaactggtcgatatcgaggcggtggccaagatc
gcccatgcgggcggagccaagctcatcgtcgacaacgtctttgccaccgcgctctaccag
agcccgctcaagctgggcgcggacctggtgacctattcggccaccaagcatatcgacggc
cagggccgggcgctgggcggactgatcctgggcagcaaggagctgatcacgggggacgtg
catacgttcatccgccagaccggcccctcgatcagcccgttcaatgcctggatgatgctc
aagggcctggagacgctgccgctgcgcgtacgccagatgaccgagaacgcgaccaggatc
gccgacttcctgggcgatcaccccaaggtcaaccgggtgatctacccgcaccacaagagc
cacccgcaatacgagctggccaagcgccagatgaaggcgggttcgaccctggtggccttc
gaggtcaagggcgggcaggaagccgcgttcaagctggcggactcgctggcggtgatcctg
atctcgaacaacctgggcgacgccaagtcgatcatcacccatccgcgcaccaccacgcac
cagcgcctgaccgaggaagtgcggctcgaatccggcatcaccccgggcatgctgcgcatc
tcggtggggctggaaaatgccgacgacctgatcgcggacctcggctacgggctcgaccag
atctga

DBGET integrated database retrieval system