KEGG   Drosophila erecta: 26526429
Entry
26526429          CDS       T01060                                 

Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    26526429
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     26526429
SSDB
Motif
Pfam: PfkB Phos_pyr_kin
Other DBs
NCBI-GeneID: 26526429
NCBI-ProteinID: XP_015015505
FlyBase: FBgn0277910
UniProt: A0A0Q5WJI5
LinkDB
Position
Unknown
AA seq 420 aa
MGKSLDVVVFGTATIDYITYVPELPKPGELVAGTYMETCFGGKGANQCVAAAKLGASTVL
VAKLGKDESGDGYLNYLQQQEVDVTHVQQVENNPTGMSEIAVSEDGEQYKINVAGANDLL
TAKDVNRAKKSFQDAKVLLCQLETNMNATMCALRQFKGVSLLHMSPMRRDIPKGMIALPS
ILVVNQEAAASLTDMEEVKTPDQARLAADSLIEKGAKSVIITLGEQGAAYMSKKSKDTCT
LVPASDVPHLADSSGAGDAFMGSLAYHIARFPKLSTEHHISAAHSCAAYSMGRRGTQPSF
PGKEGARNDLCYSTPTFSVIPPPSSQNEEDPEVPKSSPPSIVGPSPQEAPALKEVVEEPP
AAPPQDPILDASQPKAVETSNEPPQPTVEPTDEPPKPAENADEAPKPAVETANEPPANKA
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgggaaagtcgctggatgtggttgtcttcggaacggcaaccatcgactacataacctat
gttccggaattgccgaagcccggtgaactggtcgccggaacgtacatggagacctgtttc
ggtggcaagggggccaaccaatgtgtggcagcagccaaactgggggcctccaccgtcctg
gtcgcaaagttgggcaaggacgaatccggcgatggctacctgaactatctgcagcagcag
gaggtggatgtgacgcacgtccagcaggtggagaacaatcccacgggcatgagcgaaatc
gcggtttccgaggatggagagcagtacaagatcaacgtggctggtgcgaatgacctactc
acggctaaggatgtgaaccgcgccaagaaatcctttcaggacgcgaaggtgctcctctgc
caactggaaacgaacatgaatgccaccatgtgtgcgttgcgccagttcaaaggggtttcc
ctgctccacatgtcgcccatgcggagagacattccaaaaggcatgattgctttgcccagt
attttggttgttaaccaggaggcagccgccagtctaaccgatatggaggaagtaaaaacc
ccggatcaggcccgactagcagccgactcccttattgaaaagggagccaaaagcgtgatc
attaccctgggcgagcaaggagcggcttacatgtccaagaagagcaaggatacgtgcacc
cttgtgcccgcctccgatgtgccgcacttggccgattcttcgggggcaggagatgctttt
atgggcagcttggcctatcatatagctcggttccccaaactgtccaccgagcaccacatc
agtgcggcccactcctgtgccgcctactccatgggccgccgcggcactcagccaagtttt
ccgggcaaggagggcgccagaaatgacctatgctattcgacgcccacctttagtgtcatt
ccacctcctagttcgcaaaacgaagaggatcctgaggtgcccaaaagttcaccgccttca
atagtgggtccttctccccaggaagctcccgccctaaaagaagttgtggaagaaccgcca
gcagctccaccgcaggatccgattctggacgcaagtcagccgaaggcagtcgaaacgtcc
aacgaaccaccgcaacccacggttgaacccactgatgaacctccaaagcctgcggagaat
gcagatgaagctccgaaacctgccgtggagactgctaatgaaccacctgctaataaggct
taa

KEGG   Drosophila erecta: 6555676
Entry
6555676           CDS       T01060                                 

Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6555676
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     6555676
SSDB
Motif
Pfam: PfkB Phos_pyr_kin TssR
Other DBs
NCBI-GeneID: 6555676
NCBI-ProteinID: XP_001982409
FlyBase: FBgn0105076
UniProt: B3P982
LinkDB
Position
Unknown
AA seq 304 aa
MAQTEVLVFGSAIIDFISYTPRLPRPGETLHGHRFQTGYGGKGANQCVAAARQGSRTALV
AKLGADTFGSDYLRHLREERINVDHVEQLADQTTGVAQIAVSDGGENNIIIVVGANNQLS
SSDVSAAEPLFREAKVLVCQLETPIEATLTALKSFRGVSIVNAAPAMADTPPELLQLASI
FCVNESEAALMTKMSDIGNVEQAEDAVGKLIEAGANTVIITLGKLGAVFGSADSKGVCQH
VAAPIVPPEKVVDTTGAGDAFIGALAHNLARHPNGKLEDHIAAACAVASQSVQLHGTQSS
FPKA
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcccaaacggaagtgctagtctttggctcggccatcatcgacttcataagctacaca
ccccgtctgccgagacccggagaaacgcttcacgggcatcgcttccagactggctacggc
ggaaagggcgccaatcagtgtgtggccgccgcgcgccagggatcccgcacggctctggtg
gccaaactaggcgcagacaccttcggcagcgactacttgcggcatctgcgcgaggagcgg
atcaatgtggaccacgtcgagcagctggcggaccagacgacgggcgtggcccagatagcc
gtgtccgatggcggcgagaacaacattatcattgtggtgggcgccaacaatcagctgagc
tcatccgacgtctccgcggcggagccgctcttccgggaagccaaggttctggtctgccag
ctggagacgcccattgaggccaccctgactgccctcaaatccttccggggcgtgtccatt
gtgaacgcggctccggccatggcggacacaccccctgaactgctccagttggccagcatc
ttctgtgtgaacgaaagcgaagcggccttaatgacaaagatgagcgacattgggaacgtg
gagcaagccgaagatgcggttggaaagctgatagaggcaggtgccaacacggtgatcata
actttggggaaactgggagccgttttcggctccgccgactccaagggcgtgtgccagcat
gtggctgctccgattgtgccgcccgaaaaggtggtggacacgacgggggccggcgacgcc
ttcattggggccttggcccacaacttggcccgtcatccaaatgggaaactcgaggaccac
atagccgccgcatgtgccgtggcctcgcaatccgtgcagctccacgggacgcagtccagc
ttcccaaaggcctag

DBGET integrated database retrieval system