KEGG   Drosophila erecta: 6541051
Entry
6541051           CDS       T01060                                 

Definition
(RefSeq) phosphoglucomutase-2
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
der  Drosophila erecta
Pathway
der00010  Glycolysis / Gluconeogenesis
der00030  Pentose phosphate pathway
der00052  Galactose metabolism
der00230  Purine metabolism
der00500  Starch and sucrose metabolism
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Module
der_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
der_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6541051
   00030 Pentose phosphate pathway
    6541051
   00052 Galactose metabolism
    6541051
   00500 Starch and sucrose metabolism
    6541051
   00520 Amino sugar and nucleotide sugar metabolism
    6541051
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6541051
Enzymes [BR:der01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     6541051
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Other DBs
NCBI-GeneID: 6541051
NCBI-ProteinID: XP_001970362
FlyBase: FBgn0102891
UniProt: B3N7L6
LinkDB
Position
Unknown
AA seq 623 aa
MCQAGGQMLCEIKNMVLSGDPELDGEIRKWIRWDKCASTACQIMDAVRAKDWDTLRKRLC
TRISFGTAGLRACMRAGFDSMNELVVIQTAQGLCEYIKEQYPDPADWSGRGIVFGYDGRY
NSHRFAELSAIVFLNNDFKVWLFKRYVATPMVPFAILRLQCLAGVMVTASHNPKEDNGYK
VYWTNGAQIIPPHDEGIQEAILNNLEPKGSSWDDSAMCSNTMLEDPYDIVVPPYFDILKK
KLPCTMLEPNGRCPISFTYTAMHGVGYEFVKQAFARINMKPFISVCEQQEPDPEFPTTPM
PNPEEGKTSLDLSIRTAKANSSQIILANDPDADRLAVAEVREDGSYKLFSGNEVGALLGW
WSLELHKMREPDCDVSNCVMIASTVSSKILRAMGEREGFQFFETLTGFKWMGNKAIEQQQ
AGKTVLFAFEEAIGFMVGTAVLDKDGVSAAAHLATMACYLRCKLCMTLQEKLRDIYETYG
FHTTISSYVICRCPPVIEQIFERLRTWDEGKADTYPTSILNGEYEIENVRDLTTGFDSST
GDKKATLPTSSSSQMITFTFKNGLVVTLRTSGTEPKMKYYAEMCGKPDEKNWGKLTNTMN
TMVEAIVEEFYEPSKNGLQRKKE
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgtgtcaagccgggggccagatgctgtgcgagatcaagaacatggttctttcgggcgat
ccggagctagatggcgagatccgcaagtggattcgatgggacaaatgtgccagcaccgcc
tgccaaatcatggacgcagttcgggcaaaggattgggacacgctgcgcaaaaggctgtgc
acccgcatcagctttggcactgcagggttgagggcttgcatgcgggctggttttgactcc
atgaacgagctggtggtcattcagacggcgcagggcttgtgcgagtacatcaaggaacag
taccctgatccggcggactggtccgggcgtggcattgtcttcgggtatgacggtcggtac
aatagccaccgtttcgccgagctatcggccattgtgttcctaaacaacgatttcaaggtg
tggttgttcaagcgctacgtggccacgcccatggtgccttttgccatcttgaggctccag
tgcttggccggcgtcatggtgactgcctcacacaatcccaaggaggacaatggctacaag
gtgtattggaccaatggagctcaaatcatcccaccacacgacgagggtatacaggaggca
attttaaacaatttggagcccaagggatcatcctgggacgactcggcgatgtgttcgaac
acaatgctggaggatccgtacgacatcgttgtgccgccatatttcgatatcctaaagaaa
aaactgccctgtactatgcttgagccaaacggaaggtgtcctatctccttcacctatacg
gccatgcatggcgtgggctatgaatttgtgaagcaggctttcgcccgaatcaatatgaag
ccgttcatttcggtgtgcgagcagcaggagccggacccagagtttcccaccactccgatg
cccaatccggaggagggaaagacctctttggatttgtccattagaacagcgaaagccaac
agtagccaaatcattttagccaacgatcccgatgccgaccgcctggcagttgccgaagtg
cgggaggatggtagctacaagctgttcagtggcaacgaggtgggcgccctcctgggctgg
tggtctctagagctgcacaaaatgcgagagcccgactgcgacgtaagcaactgcgtgatg
atagctagtacggtgagctcaaagatcctcagggccatgggagagcgggaaggcttccag
ttcttcgaaacactgacaggttttaagtggatgggcaacaaggcaatcgagcaacagcag
gctggaaagacggtgttgtttgccttcgaagaggctatcggctttatggtcggcactgcc
gtgcttgacaaggatggtgtcagcgcggctgcccatttggccaccatggcgtgctatctt
cggtgcaaactgtgcatgacactgcaggagaaacttcgtgacatatacgagacatatggg
ttccacacgactatcagctcctatgtcatatgccgctgcccgccggtcatcgagcagatc
tttgagcgcttgcgcacatgggacgagggcaaggcagacacctatccgaccagcatcctt
aacggcgagtacgagatcgaaaacgtccgtgatctaaccactggattcgacagtagcact
ggcgacaagaaggccaccttgccgacaagctccagctcccagatgatcacatttaccttt
aaaaacggccttgtagtcactctacgcaccagcggcacggagcccaagatgaagtattac
gccgagatgtgtggcaaaccggacgagaaaaactggggcaagctgactaatactatgaac
accatggtggaggccattgtggaggaattctatgagccaagcaagaacggcctccagcgc
aagaaggagtaa

KEGG   Drosophila erecta: 6544893
Entry
6544893           CDS       T01060                                 

Definition
(RefSeq) phosphoglucomutase
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
der  Drosophila erecta
Pathway
der00010  Glycolysis / Gluconeogenesis
der00030  Pentose phosphate pathway
der00052  Galactose metabolism
der00230  Purine metabolism
der00500  Starch and sucrose metabolism
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Module
der_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
der_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6544893
   00030 Pentose phosphate pathway
    6544893
   00052 Galactose metabolism
    6544893
   00500 Starch and sucrose metabolism
    6544893
   00520 Amino sugar and nucleotide sugar metabolism
    6544893
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6544893
Enzymes [BR:der01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     6544893
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Other DBs
NCBI-GeneID: 6544893
NCBI-ProteinID: XP_001973181
FlyBase: FBgn0105767
UniProt: B3NI51
LinkDB
Position
Unknown
AA seq 560 aa
MSLTVEIVATKPYEGQKPGTSGLRKKVKVFTQPNYTENFVQAILEANGAALVGSTLVVGG
DGRFYCKEAAELIVRLSAANGVSKLLVGQNGILSTPAVSSLIRHNKALGGIVLTASHNPG
GPENDFGIKFNCENGGPAPDAFTNLIYKITTEIKQYKLVRNLQIDITKVGVTSFDIAGKP
FTVEVIDSVANYVRHMEEIFDFAKLKDFVSGKATGKPLKMRIDAMNGVTGSYVREIFLNR
LGATESSVVHTTPLPDFGGLHPDPNLTYAKDLVDTVAQGDYDIGAAFDGDGDRNMIIGSK
AFFVTPSDSLAVIAHYLEAIPYFQKNGVQGFARSMPTASAVDLVGRKLGKEVFEVPTGWK
YFGNLMDAGRLCLCGEESFGTGSNHIREKDGIWAVLAWISVMQHTGKGIEDILKQHWSVY
GRNYFTRYDYEECASDPCNEMVATMEKAITAPEFVGKSYSSGGKTYKVKEADNFSYTDPV
DKSVATKQGLRIVFEDGSRIVVRLSGTGSSGATVRLYIDSYEKENVLGQASVMLKPLIDI
ALEISQLPKFTGRNAPTVIT
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgtcgctaacggtggaaattgtagccacaaagccctacgagggtcagaagccaggaacc
agtggattgcgcaaaaaggttaaggttttcacccagccgaactacacggaaaactttgtc
caggccatattggaagccaatggagctgctctggtgggttccacgctcgtagttggtggc
gatggacgtttctactgcaaggaggctgccgagctaattgttcggctatccgctgccaat
ggggtctccaagctgctggtgggtcagaacggcatcctgtccacccccgccgtatccagc
ctgatccgtcacaacaaggctttgggcggcattgtattgactgcatcccacaatcccggt
ggtccagagaatgacttcggcatcaagttcaactgcgagaacggaggacctgccccggac
gcgttcaccaatctgatctacaagattaccaccgagatcaagcagtacaagctggtgcgc
aaccttcagatcgacatcacaaaggtgggtgtaacttcgttcgacatcgccggaaaacca
tttaccgtggaggtgattgattcggtggccaactatgtgcgccacatggaggagatcttc
gactttgcaaagctgaaggacttcgtgagtggaaaagccactggaaagcctttgaaaatg
cgcatcgatgcgatgaatggagttaccggctcctatgtgcgggagatcttcctgaaccgc
ttgggtgccaccgagtcatcggttgttcacaccactccactgccggactttgggggtctg
catcctgacccaaatctcacatacgccaaggacctggttgacactgtcgcccagggagac
tatgacataggagctgcttttgatggagatggtgaccgcaacatgatcattggaagcaag
gctttcttcgtaactcccagcgactcgctggcagtgattgcacactacctggaggccata
ccgtacttccaaaagaatggtgttcaaggattcgcccgtagtatgccgactgcatccgct
gtggacttggtgggtagaaagttgggcaaggaggtgtttgaggttcccactggatggaag
tacttcggtaacctcatggacgccggaaggttgtgtctctgcggagaggagagctttgga
actggctccaatcacatccgcgaaaaggacggcatctgggcagttctggcctggatatcc
gtgatgcagcacacgggtaaaggcatcgaagacatccttaagcagcactggtctgtgtat
ggacgcaactactttacccgctacgattatgaggagtgcgcttctgatccttgcaacgag
atggtggccaccatggagaaagccataactgctccggagttcgtcggcaagagctattca
agcggcggaaaaacctacaaggtcaaggaggccgacaacttcagctacacagatccggtc
gacaagtcggtggccaccaaacagggtctgcgcattgtgttcgaggatggcagccgcatt
gtggtgcgcctcagtggaactggaagctcgggagcaaccgttcgcttgtacattgattcc
tatgagaaggagaacgttttgggtcaggccagcgtgatgctgaaacccttgatcgacatc
gctctggagatctctcagctgcccaagttcactgggcgcaatgctcccacggtcatcacg
taa

KEGG   Drosophila erecta: 6549059
Entry
6549059           CDS       T01060                                 

Definition
(RefSeq) glucose 1,6-bisphosphate synthase
  KO
K15779  phosphoglucomutase / phosphopentomutase [EC:5.4.2.2 5.4.2.7]
Organism
der  Drosophila erecta
Pathway
der00010  Glycolysis / Gluconeogenesis
der00030  Pentose phosphate pathway
der00052  Galactose metabolism
der00230  Purine metabolism
der00500  Starch and sucrose metabolism
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
Module
der_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
der_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6549059
   00030 Pentose phosphate pathway
    6549059
   00052 Galactose metabolism
    6549059
   00500 Starch and sucrose metabolism
    6549059
   00520 Amino sugar and nucleotide sugar metabolism
    6549059
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6549059
Enzymes [BR:der01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     6549059
    5.4.2.7  phosphopentomutase
     6549059
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III DUF1380 eIF3m_C_helix
Other DBs
NCBI-GeneID: 6549059
NCBI-ProteinID: XP_001975581
FlyBase: FBgn0114568
UniProt: B3NQS1
LinkDB
Position
Unknown
AA seq 628 aa
MSISLKRKTVISPQDLLKTLELSGEEDLDLQIKNWVMWDRNEATLEQVTEAVRDQDWDAL
RVRLCHRITYGATGLRGVMRAGFDSLNDVVIIEVAQGICAYLIDAYPSIQKRQTQGVVIG
YDGRYNSKRFAQLISSVFLNNDFKVYLFTRMTPTPFIPFTIVTLQCLAGIVVTASHNTKE
DNGIKVYWTNGAQAMAPHDQRIHDYMMNNLEPKPSSWETSVVLDHPLVEDPYRQIYPLFY
ETLKQLLPPIYLETNECSQLRFIYTALHGVGYPFMREAFYQARLKPVIPVVEQKEPDPEF
PTLISPNPEEGREALKLAIKKADAEHCTLILANDPDVDRLAVAELDPRGRWKLFNGNELG
ALLGWWALENYRTRTPKPAVSNCIMIASLVSSRILAAMARVEGFIFVEGMPSFPWMAHRA
LELQKSGRTVLFAFEDCFGYMFGMSLPDKEGIGAAMQLASMACYLRSTRNVTLIEKLREI
YDTYGYHSSISSVYLADSPETITSIFAHLRNFTDEEGYPRCILEEEFEVVHIRDLTTGLD
TSFSDGKARMPVNPNDQLITFTFTDGYVVTLRSAHNDIKIKLNAEICGLPEEKQWEELHD
KLNRMTNAVVEEFLMPEENGLTDASAIQ
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgtccatctcgctgaagcggaaaacggtgatttcgccgcaggacctcctgaagacgctc
gagctgtccggcgaggaggacctcgatctgcagatcaagaactgggtgatgtgggaccgg
aatgaggcgacgctcgagcaggtgaccgaggcagtcagggatcaggactgggatgccttg
cgggtgagactgtgccacaggatcacctatggggccacgggcttgaggggcgtgatgcgg
gctggcttcgactccttgaacgatgtggtgatcatcgaagtggcccagggcatctgcgcc
tacctcatcgatgcctatccgagcatccagaagaggcaaacgcagggcgtggtcattggc
tacgatggaagatacaatagcaagcggtttgcccagctcatctcctccgtgttcctgaac
aacgatttcaaggtgtacctcttcacccgcatgaccccgacgccctttatacccttcacc
atcgtgacgctgcagtgcctggcggggatcgtggtcactgcctcccacaataccaaggag
gacaatggcatcaaggtttattggacgaatggcgctcaggcgatggctccgcacgatcag
cggattcatgactatatgatgaataacctggagccgaagccttcgtcctgggaaacttcg
gtggtactcgaccatcccttggtggaggatccctatcgccagatatacccactcttctac
gagactctcaagcagcttctacccccgatttatctggagactaatgagtgcagccagttg
aggttcatctacacggctcttcacggggtggggtatcccttcatgagggaggccttctac
caggcgcgactcaagccggtgattcccgtggtggagcagaaggagcccgatccggagttt
cccaccctgatctcgccaaatccggaagagggcagggaagccctgaagctggccataaag
aaggcggacgcggagcactgcaccttgattctggccaacgatccggatgtggatcgcctg
gctgtggccgagctggatccgcggggccgctggaagctgttcaatggcaacgaactgggc
gctctgctcggctggtgggcactggagaactacaggaccaggacacccaagccagccgtg
tccaactgcataatgatagcctcactggtcagctcacgcatcctggcggccatggcaagg
gttgagggcttcatctttgtggagggcatgcccagttttccctggatggcgcatcgcgcc
ttggagctgcaaaagtctggaaggacagtgctcttcgcgttcgaggattgctttggctac
atgttcgggatgagcctgccggataaggagggcattggtgctgccatgcagttggccagc
atggcctgttatctgcgcagcacgcggaacgtgacgctgatcgagaagctgagggagatc
tacgatacatatggctaccactcgtcgatctcatcggtttatttggccgatagtccagag
acaatcactagcatcttcgctcacttgcgcaactttacggacgaggagggctatcccagg
tgcatcctggaggaagaattcgaggtggttcatatccgggacttgaccaccggtctggac
acctccttcagcgatggtaaggctcgcatgccggtcaatccaaatgaccagctgattact
tttaccttcaccgatggctatgtggtcaccctgcgatcggctcacaacgatatcaagatc
aaactgaacgcggagatctgtggtctgccggaggaaaagcagtgggaggagctccacgac
aagctgaacaggatgaccaacgccgtggtggaggagttcctcatgcccgaggagaatggt
ctcacggatgcctcagcgattcaataa

DBGET integrated database retrieval system