KEGG   Drosophila erecta: 6541174Help
Entry
6541174           CDS       T01060                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X2
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
der  Drosophila erecta
Pathway
der00562  Inositol phosphate metabolism
der01100  Metabolic pathways
der04068  FoxO signaling pathway
der04070  Phosphatidylinositol signaling system
der04140  Autophagy - animal
der04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    6541174
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    6541174
   04070 Phosphatidylinositol signaling system
    6541174
   04150 mTOR signaling pathway
    6541174
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6541174
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:der01009]
    6541174
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     6541174
    3.1.3.48  protein-tyrosine-phosphatase
     6541174
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     6541174
Protein phosphatases and associated proteins [BR:der01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    6541174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 DSPn
Motif
Other DBs
NCBI-GeneID: 6541174
NCBI-ProteinID: XP_015014985
UniProt: A0A0Q5WAE1
LinkDB All DBs
Position
Unknown
AA seq 418 aa AA seqDB search
MANTISLMSNVIRKVVSKQRIRYNEKGYNLDLTYICDNIIAMGYPATDKLERLYRNRMED
VLKFLEENHGRHYKIYNLCSERSYDVAIFHGRVAVLPFEDHNPPTIELIQRFCMDVDLWL
KEDSSNVVAVHCKAGKGRTGTMICAYLVFSGLQKSADDALAWYDEKRTKDRKGVTIPSQR
RYVQYFSKLVCSSVPYSKISLNVCEIRFSESSCLQNLGTVQCSVSVLHDSATENAEPDKQ
KTWKIDFKKSFVLTIKPSLPVSGDVKFELTQKSPEKIICHFWLNTFFVRNYSPCESDGTV
NKYIHTLGKSEIDDVHKDREHKTFSEEFKISIVFEAEQFSNDVQTEPSEKERNENVLNFE
RSDYDSVSPNCFPEKKVLTAIVNDNTAKSQTIEPLDHKDIVVNQHTCNQCLLRTYNSW
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggccaacactatttcgttaatgtccaacgtgatacgcaaggtagtgagtaaacaacgt
atacgatacaatgaaaaaggatacaatttggatttaacatacatttgtgataacataatt
gccatggggtatccagcaacggataaactagagcgcctatacagaaaccgaatggaagat
gtccttaagtttttggaagagaatcatggcaggcattacaaaatatataacctatgctca
gagcgtagttacgacgttgctatatttcacgggagagtagctgttctaccgttcgaagac
cataaccctccaacgattgagttaatacaacgattttgcatggatgttgatttatggctc
aaggaagattcgtccaatgttgtagccgtgcactgtaaagctggaaaaggcagaaccggt
accatgatctgtgcatatttagtgttcagtggacttcaaaaatccgctgatgatgcatta
gcgtggtatgatgagaaacgtacaaaggaccgaaaaggtgtgacaatcccatctcagcgt
cgatatgttcagtatttttccaaactagtttgttcaagtgttccatattcgaaaataagc
cttaacgtatgtgaaatacggttctcggagtccagttgtttgcaaaacttaggcacggta
caatgttcagtatctgtattacacgactctgccacagaaaatgcagagccagataaacag
aaaacctggaagattgattttaaaaaatcatttgttttgaccattaaaccatctttacca
gtttccggtgatgtaaaattcgaactcacacaaaaatcaccagagaaaatcatttgtcac
ttttggctaaatacattttttgtgcgaaattattcaccttgcgagtccgatggaacagtt
aacaaatatatacacactttaggtaaatcagaaatcgatgatgtacataaagacagagaa
cataaaacgttttcagaggaattcaagatttcaatcgtatttgaggcagaacaatttagt
aacgatgttcaaactgaaccgtctgaaaaagagagaaatgaaaatgttttaaattttgaa
agatcagactatgacagtgtatctccaaactgctttcccgaaaaaaaagtcttaactgcg
atcgtcaatgataatacagcgaaaagtcaaacaatagaaccgttggatcataaggatata
gttgtgaatcaacatacctgtaatcaatgcttattacggacttataattcttggtga

DBGET integrated database retrieval system