KEGG   Drosophila erecta: 6541849
Entry
6541849           CDS       T01060                                 

Definition
(RefSeq) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
der  Drosophila erecta
Pathway
der00010  Glycolysis / Gluconeogenesis
der00030  Pentose phosphate pathway
der00500  Starch and sucrose metabolism
der00520  Amino sugar and nucleotide sugar metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
Module
der_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
der_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
der_M00892  UDP-N-acetyl-D-glucosamine biosynthesis, eukaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6541849
   00030 Pentose phosphate pathway
    6541849
   00500 Starch and sucrose metabolism
    6541849
   00520 Amino sugar and nucleotide sugar metabolism
    6541849
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:der04147]
    6541849
Enzymes [BR:der01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     6541849
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   6541849
  Exosomal proteins of other body fluids (saliva and urine)
   6541849
  Exosomal proteins of colorectal cancer cells
   6541849
SSDB
Motif
Pfam: PGI
Other DBs
NCBI-GeneID: 6541849
NCBI-ProteinID: XP_001970401
FlyBase: FBgn0102918
UniProt: B3N847
LinkDB
Position
Unknown
AA seq 558 aa
MAGPLPPLNQEAAFQKLQDYYDSNGKDLNIKDLFVKDSKRFSKYSLRLHTQNDGEILLDY
SKNRINDEVWDLLLALAKVRRVDAARDAMFSGQHINITENRAVLHTALRNRGTDPVLVDD
KDVMHDVRKELAHMKEFTNMVISGVWRGCTGKQITDVVNIGIGGSDLGPLMVTEALKPYG
KGLHSHFVSNIDGTHLAEVLKKVNYETTLFIVASKTFTTQETITNATSAKTWLLEHSKEP
ESVAKHFVALSTNKEKVTEFGIDSTNMFGFWDWVGGRYSLWSAIGLSICLSIGFENFEQL
LDGAHFMDNHFRTTPFEKNAPVILALLGVWYSNFFKAETHALLPYDQYLHRFAAYFQQGD
MESNGKFVSKAGKAVKYSTGPIVWGEPGTNGQHAFYQLIHQGTRLIPCDFIAPAQTHNPI
AGGKHHKILLSNFLAQTEALMAGKTVDEARAELSKAGLCGNELDNLLPHKVFVGNRPTNS
IVVKKVSPFTLGALIALYEHKIFVQGIIWDINSFDQWGVELGKQLAKAIEPELDHCNEVS
THDSSTNGLINFIKANWK
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggccggcccacttcctccgctcaaccaggaggctgcgttccagaagctgcaggactac
tacgactccaatggcaaggatctgaacatcaaggacctgttcgtgaaggactccaagagg
ttctcaaaatacagtctgcgcctgcacactcagaacgatggcgagatactgctagactac
tcgaagaaccgcatcaatgacgaggtctgggacttgctcctcgccctggccaaggtgcgt
cgcgtggacgcggcgcgggacgccatgttctccggccagcacatcaacatcacggagaac
cgcgccgtcctgcacacggccctacgcaaccgcggcacggaccccgttctggtggacgac
aaggacgtgatgcacgatgtgcgtaaggaactggcccacatgaaggagtttaccaacatg
gttatctccggcgtgtggcgcggctgcaccggcaaacagatcaccgacgtggtcaacatc
ggcatcggtggctccgatctgggcccgctgatggtcactgaggcgctaaagccatacgga
aagggcctccactcccactttgtgtcgaacattgacggcacccacctggccgaggtcctc
aaaaaggtcaactacgagaccaccctcttcatcgtcgcctcaaagactttcaccacccag
gagaccattacgaacgccacctccgccaagacctggctcctggagcattccaaggagcct
gagtccgtggccaagcattttgtggccctgtcgactaacaaggaaaaggtcaccgaattc
ggcattgatagcaccaatatgttcggtttttgggattgggtgggcggacgctactcccta
tggtcggccatcggactgtcaatctgtctgtccattggctttgagaactttgagcagctg
ctggatggagctcatttcatggacaaccatttcaggacgacacctttcgagaaaaatgct
cccgttatcctggctttgctcggcgtttggtactccaacttcttcaaagcggaaacacat
gccctccttccatacgatcagtacttgcatcggtttgccgcctacttccagcagggcgat
atggagagcaacggcaagttcgtcagcaaggcgggcaaggccgtgaagtacagcactggt
ccgattgtgtggggcgagccgggcaccaacggccagcacgccttctaccagctcatccac
cagggcacccgcctgattccttgcgacttcatcgcccctgcccagacacacaaccccatt
gccggcggcaagcaccacaagattctgctgtcgaatttccttgcccagacggaggcttta
atggccggaaagacggtcgacgaggccagggccgagctttcaaaggctggtctgtgcggc
aacgagctggataacttgttgccccacaaggtgttcgttggcaaccggcccacaaactct
attgtggtgaagaaggtctcacctttcaccctgggcgcgttgattgcgctgtacgagcac
aagatctttgttcagggcatcatttgggacatcaactcgtttgaccaatggggtgtggag
ctgggcaagcagctggccaaggccatcgagccggagctggatcactgcaacgaggtctcc
acgcacgacagttccacgaacggcctaattaacttcatcaaagccaattggaagtaa

DBGET integrated database retrieval system