KEGG   Drosophila erecta: 6542142
Entry
6542142           CDS       T01060                                 

Definition
(RefSeq) glycerate kinase
  KO
K11529  glycerate 2-kinase [EC:2.7.1.165]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der00260  Glycine, serine and threonine metabolism
der00561  Glycerolipid metabolism
der00630  Glyoxylate and dicarboxylate metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6542142
   00630 Glyoxylate and dicarboxylate metabolism
    6542142
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    6542142
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    6542142
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     6542142
SSDB
Motif
Pfam: DUF4147 MOFRL
Other DBs
NCBI-GeneID: 6542142
NCBI-ProteinID: XP_001968415
FlyBase: FBgn0116987
UniProt: B3NA11
LinkDB
Position
Unknown
AA seq 487 aa
MAKRQTWEQMRQIFVQAVNAVHPEKVFADFQKFDLRPQSGENPADISIKLNGERQDISGK
KCHIVGFGKAVLGMANKVQQDLGATSAGGVLSVPVNTLMQFQQPVASGLVVHEGAANNLP
DENALKAAREIKQLAEKMTAQDILFVFISGGGSALLPLPRSPLTLEDKRSIADKLMKRGA
SIQEINTVRIACSDIKGGRLARLAGKAGLLVTFVLSDIIGDPLELIACGPTIQPEAGASP
SDILKKHHVWEELSAEIQRVFEQPEEQMHTSLPEHKVFVVGSNLIATSTAAKEAENLGYI
PCVLSCAVQGDVAQVAGDYQRLLHGIQEAKQQGILDPQLRERYAFGESSYPAFRRALEEH
MNSKKPLFLICGGEPVIKVSGQGLGGRSQHLALLMSQALHRDEAIRNCTFLSAGTDGIDG
PTDAAGAMGDSSVVESYLGDHTLDELAETLRNCDSYNFYKNLAQGEHHVLTGHTGTNVMD
LHFLVVP
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggccaagcgacagacttgggagcagatgcgccagatctttgtccaggcggtaaacgcc
gtgcatcctgagaaggtattcgctgacttccaaaagttcgatttgcggcctcaaagcggc
gagaacccagcggatatatccataaaactcaatggagagcgtcaggacatcagcgggaag
aagtgccacatagttgggtttggcaaagcagtcctgggaatggccaacaaagtgcagcag
gatctgggagccacctcggccggcggagtcctcagtgttccggtaaacaccctgatgcag
ttccaacaacctgttgcatctggtttggttgtccacgaaggagcggccaacaacctgccg
gatgagaatgctctcaaggcagcccgggaaatcaagcagctggccgagaagatgaccgcc
caggacatcctcttcgtcttcatctcgggaggtgggtctgcccttttgccgttgccccgg
tcacctctgactctggaggacaagcgaagcattgcggataaacttatgaagcggggagcc
agcatccaggagattaatactgttaggattgcttgctcggacatcaagggcggtcgcttg
gccaggcttgccggcaaggcgggcctcctggtgaccttcgtgcttagcgacatcatcggt
gatcccctggagctgatagcctgcggtcccaccatacaacccgaggcgggagcatctcca
tccgacatcctcaaaaagcatcatgtgtgggaggagctgtccgccgagatacagcgggtg
tttgagcagccggaggagcagatgcacacatcgctgcccgagcacaaggtatttgtggtg
ggcagcaatctgatagccacttccacagcggccaaggaggccgaaaatctgggttatatt
ccctgcgtgctcagttgtgctgtgcaaggagacgtggcccaagtggctggcgattatcaa
agattgctgcacggcatccaggaggccaagcagcagggcatactggatccccagctcagg
gagaggtacgcctttggagagagcagttatccggcttttcggagggccctggaagagcac
atgaacagcaagaaaccactgttcctgatctgtggaggagagccagtcattaaagtttct
ggtcaaggattgggcggcaggagtcagcacttagccctgctgatgtcgcaagctctgcac
cgcgacgaggccatacggaactgcaccttcctgagcgccggaactgatggcatcgatgga
cccaccgatgcggccggagctatgggagacagcagcgtggtggaatcctatctgggtgat
cacaccctcgatgaactggccgaaacgctgcggaattgcgacagctacaacttttacaag
aatctcgcgcagggagagcaccacgtgctcactggacacacgggtaccaatgtgatggat
ctgcatttcctggtcgtgccgtag

DBGET integrated database retrieval system