KEGG   Drosophila erecta: 6542147
Entry
6542147           CDS       T01060                                 

Definition
(RefSeq) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der00040  Pentose and glucuronate interconversions
der01100  Metabolic pathways
der01200  Carbon metabolism
der01230  Biosynthesis of amino acids
Module
der_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
der_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6542147
   00040 Pentose and glucuronate interconversions
    6542147
Enzymes [BR:der01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     6542147
SSDB
Motif
Pfam: Ribul_P_3_epim QRPTase_C PG_binding_3
Other DBs
NCBI-GeneID: 6542147
NCBI-ProteinID: XP_001970607
FlyBase: FBgn0103036
UniProt: B3N9X0
LinkDB
Position
Unknown
AA seq 221 aa
MSVQPKIGPSILNADLSNLAAESQKLLDNGADYLHLDVMDGTFVPNLTFGHPMVKSLRNK
IKTAFFETHMMVQNPEQWIEPMADAGVNLYTFHVEPVQDVVRVSRQVRESGMKVGLAIKP
GTEVQDLEKYVSIADVVLVMTVEPGFGGQSFMADMMPKVKWLRDNYPSLDIEVDGGVGPK
TIHCCAEAGANMIVSGTAVVGASDQAQVIKEMRDVVRSYLK
NT seq 666 nt   +upstreamnt  +downstreamnt
atgtccgttcaacccaagatcggtcccagcattcttaatgcggatttatccaatctggcg
gcggagtcgcaaaagctactggacaatggagcggactacctgcatctggacgtgatggac
ggcactttcgtgccgaatcttaccttcggtcaccccatggtcaagagcttgcgcaacaag
atcaagacggcctttttcgagacgcacatgatggtccagaatccggagcagtggatagag
cccatggccgatgcgggtgtcaatctttacaccttccacgtcgagccggtgcaggatgtg
gtcagggtcagtcgccaagtgcgggagtccggcatgaaggtgggccttgccattaagccg
ggcactgaggtacaggatctggagaagtacgtgagcattgccgacgttgtgctggtgatg
accgtggagcctggttttggcggacagtccttcatggccgatatgatgccgaaggtgaag
tggctgcgcgataactaccctagcctggacatcgaggtggacggaggagtgggacccaaa
accatacactgctgtgccgaggccggagccaacatgatcgtttcgggaaccgccgtggtg
ggcgcctccgatcaggcgcaggtcatcaaggaaatgcgcgatgtggtgcgcagctacctc
aaatag

DBGET integrated database retrieval system