KEGG   Drosophila erecta: 6543331Help
Entry
6543331           CDS       T01060                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
der  Drosophila erecta
Pathway
der00010  Glycolysis / Gluconeogenesis
der00030  Pentose phosphate pathway
der00051  Fructose and mannose metabolism
der00052  Galactose metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
der01230  Biosynthesis of amino acids
der03018  RNA degradation
Module
der_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    6543331
   00030 Pentose phosphate pathway
    6543331
   00051 Fructose and mannose metabolism
    6543331
   00052 Galactose metabolism
    6543331
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    6543331
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:der01009]
    6543331
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:der03019]
    6543331
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     6543331
Protein phosphatases and associated proteins [BR:der01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6543331
Messenger RNA biogenesis [BR:der03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     6543331
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 6543331
NCBI-ProteinID: XP_015015049
UniProt: A0A0Q5WM25
LinkDB All DBs
Position
Unknown
AA seq 788 aa AA seqDB search
MNSEINQRFLARGSQKDKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKVYFIREGYQGM
VDGGDCIQEANWASVSSIIHRGGTIIGSARCQDFRERQGRLKAANNLIQRGITNLVVIGG
DGSLTGANLFRQEWSSLLDELVKNKTITTEQQEKFNVLHIVGLVGSIDNDFCGTDMTIGT
DTALHRIIEAIDAISSTAYSHQRTFIMEVMGRHCGYLAISAAIATEGDFMFIPEEPVSVN
WKDEICVKLQQERSAGQRLNIVIVAEGAMDREGHPITAEDVKKVIDERLKHDARITVLGH
VQRGGNPSAFDRILACRMGAEATLALMEATKDSVPVVISLDGNQAVRVPLMECVERTQAV
AKAMAEKRWADAVKLRGRSFERNLETYKMLTRLKPPKENFDADGKGIEGYRLAVMHIGAP
ACGMNAAVRSFVRNAIYRGDVVYGINDGVEGLIAGNVRELGWSDVSGWVGQGGAYLGTKR
TLPEGKFKEIAARLKEFKIQGLLIIGGFESYHAAGQIADQRDNYPQFCIPIVVIPSTISN
NVPGTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFSIKDLQQDVYHMASKMAEGVSRGLILRNEKASENYTTDFIYRLYSEEGKGL
FTCRMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWLATQIKANIDANGVVNCKSPDTATL
LGIVSRQYRFSPLVDLIAETNFDQRIPKKQWWLRLRPLLRILAKHDSAYEEEGMYITVEE
ECDTDAVA
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgaattccgagattaatcaacgtttcctggcccgcggctcgcagaaggacaaaggactg
gcggtcttcaccagcggcggggattcccagggcatgaatgccgccgtccgagcctgtgtg
cgtatggccatctatttgggctgcaaggtctacttcatccgtgaaggctaccagggcatg
gtagatggaggtgactgcatccaggaggctaactgggcctcagtctcgtccatcatccat
cgtggtggtaccatcattggctccgcccgttgccaggacttccgtgagcgtcagggtcgc
ttgaaggccgccaacaacctgatccagcgtggaatcaccaatctggtggtcattggaggc
gatggctccctcaccggcgccaatctgttccgtcaggagtggtccagtctgctggacgag
ctggtcaaaaacaagaccattaccaccgagcagcaggagaagttcaatgtcctgcacatc
gttggattggtgggctccattgacaacgatttctgtggcacggacatgaccatcggcacg
gacacggccctgcatcgcatcatcgaggccatcgatgccatttccagtaccgcctactcg
catcagcgcaccttcatcatggaggtcatgggtcgtcattgcggttacttagccatatcg
gcagccatagccacagagggtgattttatgttcatacccgaggagccggtgtcagtcaat
tggaaggacgagatctgtgtcaagctccaacaggagcgatctgctggccagcgcctgaac
atcgtgatcgtcgccgaaggagccatggatcgcgagggtcatcccatcaccgccgaggat
gtgaagaaggtgatcgacgagcgtttgaagcacgatgcccgcatcactgtcttgggtcac
gtgcagcgcggtggcaatcccagtgccttcgatcgtattttggcttgtcgcatgggagct
gaagccactttggccctgatggaggccaccaaggactcggtgccagtggtcatctctctg
gatggcaaccaggcagttcgcgtgccgctgatggagtgcgttgagcgcacccaggctgtg
gccaaggccatggcggagaaacgctgggcggatgctgtcaagctgcgcggacgctccttc
gaacggaatctggagacctacaagatgctgacgcgcttgaagccacccaaggagaacttc
gacgccgatggcaagggcatcgaaggataccgcctagctgtgatgcacattggtgctcca
gcttgcggtatgaatgccgctgtgcgcagtttcgtgcgaaatgccatctaccgcggtgat
gtggtttatggaatcaacgacggtgtcgagggtctgattgccggtaatgttcgcgagctg
ggctggtccgatgtctcaggatgggttggtcagggtggcgcctacttgggcaccaaacgc
actctgcctgagggcaagttcaaggagatcgccgctcgtctcaaggagttcaagatccag
ggtcttctgatcatcggtggctttgagagttaccatgccgccggacagatcgccgatcag
cgggacaactacccacagttctgcatccccattgtggttattccatcgacgatctcgaac
aatgtgcccggcacagaattttcgctgggatgcgacaccggtttgaatgagattacggag
atttgcgaccgtatccgtcaatcggcccagggcaccaagcgccgcgtgttcgtcatcgag
acaatgggtggctactgcggctatttggccaccttggccggtttggccggcggagctgat
gccgcctatatctacgaggagaagttctccatcaaggacctgcagcaggatgtctaccac
atggcctccaagatggccgagggcgtctcccgcggtctgatcctgcgaaacgagaaggct
agcgagaactacaccacggacttcatttaccgcctgtactcggaggagggaaagggtctc
ttcacctgccggatgaacatcctgggtcacatgcagcagggcggctcacccactcccttc
gaccgcaacatgggcaccaaaatggccgccaagtgtgtcgactggctggccacccagatc
aaggcgaacattgacgccaacggagtggtcaactgcaagtccccggacaccgccaccctg
ctgggtatcgtgtcgcgacagtaccgcttctcaccactggtcgacctcattgccgagacg
aacttcgatcaacgcatcccgaagaagcagtggtggctgcgcctgcgtcccctgctgcgt
atcctggccaagcacgactccgcctacgaggaggagggtatgtacatcaccgtcgaggag
gagtgtgacaccgacgccgtcgcctaa

DBGET integrated database retrieval system