KEGG   Drosophila erecta: 6543976
Entry
6543976           CDS       T01060                                 

Definition
(RefSeq) ribose-phosphate pyrophosphokinase 2 isoform X1
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der00230  Purine metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
der01230  Biosynthesis of amino acids
Module
der_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6543976
  09104 Nucleotide metabolism
   00230 Purine metabolism
    6543976
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     6543976
SSDB
Motif
Pfam: Pribosyl_synth Pribosyltran_N Pribosyltran UPRTase
Other DBs
NCBI-GeneID: 6543976
NCBI-ProteinID: XP_001972210
FlyBase: FBgn0106278
UniProt: B3NGK0
LinkDB
Position
Unknown
AA seq 388 aa
MPDKKCIENEQNDCVMPVRSANPIRARSLIRDNLEKQAGCLNLIHSRMPNIKVFSGTSHP
DLAQRIVDRLGIDLGKVVTKKFSNLETCVEIGESVRGEDVYIVQSGSGEINDNLMELLIM
INACKIASASRVTAVIPCFPYARQDKKDKLAGSEDNAESKKLAKKNYDWKFRSRAPISAK
LVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLKWIKENIPEWKNSIIVSP
DAGGAKRVTSIADRLNVEFALIHKERKKANEVASMVLVGDVKDKIAILVDDMADTCGTIV
HAADRLVEAGATKVYAILTHGIFSGPAISRINNACFEAVVVTNTIPQDGHMRDCPKIQCI
DVSMMFAEAVRRTHNGESVSYLFSNVPY
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgcccgataagaaatgcatcgagaacgagcagaatgattgtgtgatgccagttcgctct
gctaatccgatacgcgctagaagtttgatccgagacaatttggagaaacaggctggttgt
ctaaatttaatccactccagaatgccgaacatcaaagtgttttcgggcacctcgcatccg
gatttggcccaacggattgtcgatcgcctgggaatcgatctcggcaaggtggttacgaag
aaattcagcaatttggagacctgtgtggaaattggggaatcggtgcgcggcgaggatgtg
tacatcgtgcagtcgggatccggcgagatcaacgataacttgatggagctgctgatcatg
atcaatgcgtgcaaaatcgcctcagcctctcgtgttacagctgtgattccttgctttcca
tatgcccgccaagacaaaaaagacaagttggcaggcagtgaggataatgcggaaagcaag
aaactagccaagaaaaactacgattggaaatttaggagtcgtgcgcccatctcggccaaa
ttggtggccaacatgctgtccgttgctggagcggatcacatcataaccatggatctgcac
gcctcacagattcagggcttctttgatataccagttgataatctctacgccgagccggcg
gtgctcaagtggatcaaggagaacattcccgagtggaagaactcgatcattgtgtcgccc
gatgctggcggtgccaagcgtgtcacctcgattgccgatcgcctgaatgtggagttcgct
ctgatacacaaggagcgcaagaaggccaacgaagtggcctccatggtgctggtgggtgat
gtcaaggacaagattgccattctggtcgacgacatggccgacacatgcggcaccattgtg
catgccgccgatcgcctggtggaggccggagccaccaaggtgtatgccattctgacgcat
ggcattttctcgggtccggcgatctcgcggatcaacaatgcctgtttcgaggcggtggtg
gtgaccaataccataccgcaggatggacacatgcgggactgtcccaaaatccagtgcatt
gatgtctcgatgatgttcgccgaggccgtcagacggacacacaacggcgagagtgtctcg
tatctcttctcaaatgttccatactaa

DBGET integrated database retrieval system