KEGG   Drosophila erecta: 6544284
Entry
6544284           CDS       T01060                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der00480  Glutathione metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
Module
der_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
der_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6544284
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    6544284
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:der04147]
    6544284
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     6544284
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     6544284
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   6544284
  Exosomal proteins of colorectal cancer cells
   6544284
  Exosomal proteins of bladder cancer cells
   6544284
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-GeneID: 6544284
NCBI-ProteinID: XP_001973712
FlyBase: FBgn0105462
UniProt: B3NJ21
LinkDB
Position
Unknown
AA seq 537 aa
MISIDPHNEEAYSVVVFGASGGLAKKKVFPALWALYRENRLPPGTKIFTFTRTPLQTKTY
RLQILPYMELDKHRDPKKYNLFWKTVHCVQGEYDKPEHYVALTEAMVHQETKHNQVHANR
IFYLALPPIVFDQVALNVSRKCSSSTGWNRIIVEKPFARDDVSYKVFQTSLCNCFRESQI
YLMDHLLSRQVMQNFFALRYSNHLWGETLNNRHVAAVMISVKCELPVAASRADYFNQFGI
IRDLMTNHMIQTLAMLAMDQPYANTADDLRVERLKVLRQVLTPHIGDVVLAQYRNNRRES
EPAKCGYTEHTYIPKDSFTPTFALVVLQINNRRWSGVPFILRAGKALNDTKSEVRIQYKP
VDCDAFDSDSADIRNELVLRSFPTEEVFMRMRLKRQGESICLRESEVNLRVDDRGPKGLQ
GLPGFLLNVFHGDQTLFMRSDEQCEIWRIFSPVLATIDSDRPRPLHYDFGSRGPLLAYRK
AERAGFVFFASDEWHQSEETLEYTVKRSKQLIGPHTALKPVRDPRCKRLSSNPKAVG
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgatttccatagaccctcacaatgaggaggcgtattccgtcgtggtcttcggagcctca
ggtggattggccaagaagaaggttttcccagcgctttgggccctctaccgggaaaatcgg
ctgcccccgggcactaaaatattcaccttcacccggacaccgctgcagacgaagacgtac
cggctgcagattctgccttacatggagctggacaagcatcgggaccccaagaagtacaac
ctcttctggaagacggtgcactgcgtgcagggcgagtacgacaagccggagcactacgtg
gcgctcacggaggcgatggtccaccaggagacgaagcacaaccaggtgcacgcgaaccgg
atcttctacctggcgctgccgccgatcgttttcgaccaggtggccctcaatgtcagccgc
aagtgcagctcgtccacgggctggaaccggatcatagtggagaagccctttgcgcgggac
gacgtctcctacaaggtcttccagacctcgctgtgcaactgcttccgggagtcgcagatt
tacctgatggaccacctcctcagccggcaggtgatgcagaacttctttgcgctgcgctac
tccaaccacttgtggggcgagaccctgaacaaccgccacgtggcggcggtgatgatatct
gtgaagtgtgagctgccggtggcggcgagtcgggcagactacttcaaccagttcggcatt
attcgcgacctgatgaccaaccacatgatccagacgctggccatgctggctatggatcag
ccgtacgccaacaccgctgacgacctgcgggtggaacggctgaaggttcttcgccaggtg
ctaactccccacataggcgacgtggtcttggcccaataccgcaacaaccggcgggagtcc
gagccggcgaagtgcggctacacggagcacacctatatcccgaaggactcctttacgcct
accttcgcgctggtggtgctgcaaatcaacaaccgccgttggtccggcgtgcccttcatc
ctgcgggcgggcaaggccttaaacgacaccaagtcggaggtgcgcatccagtacaagccg
gtggactgcgacgccttcgacagcgacagtgcggacattcggaacgagctggtcctgcga
tcctttcccacggaagaggtcttcatgcgcatgcgcctcaagcggcagggcgagagtatc
tgcctccgggaaagcgaggtcaatctgcgagttgacgatcggggaccaaagggactccag
ggactgcccggcttcctactcaacgtgttccatggcgaccagacgctcttcatgcgctcc
gacgagcagtgcgagatctggcgcatattctcccctgtcctggccaccatcgattcggat
cgtccccgcccgctgcactacgacttcggatcccggggtccgttgctggcctatcgcaag
gcggagcgcgcgggcttcgtcttcttcgcctcggacgagtggcaccagagcgaggagacg
ttggagtacacggtcaagaggagcaagcagctaatcggaccccacaccgccctcaagccg
gttagggatcctcggtgcaaaaggctgagctccaaccccaaggcggtgggataa

KEGG   Drosophila erecta: 6550494
Entry
6550494           CDS       T01060                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase isoform X1
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der00480  Glutathione metabolism
der01100  Metabolic pathways
der01200  Carbon metabolism
Module
der_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
der_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6550494
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    6550494
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:der04147]
    6550494
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     6550494
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     6550494
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   6550494
  Exosomal proteins of colorectal cancer cells
   6550494
  Exosomal proteins of bladder cancer cells
   6550494
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-GeneID: 6550494
NCBI-ProteinID: XP_001977809
FlyBase: FBgn0084419
UniProt: B3NVS1
LinkDB
Position
Unknown
AA seq 524 aa
MATQKEDHTALDLIIKSLKSPTMVCEGTHFDGKIPHTFVIFGASGDLAKKKIYPTLWWLY
RDDLLPKPTKFCGYARSKLTVDSLKDQCLPYMKVQLHEQKKYEEFWALNEYVSGRYDGRT
GFELLNQQLELMENKNKANRIFYLALPPSVFEEVTVNIKQICMSVCGWNRVIIEKPFGRD
DASSQALSDHLAGLFHEDQLYRIDHYLGKEMVQNLMTIRFANKILSSTWNRENIASVLIT
FKEPFGTQGRGGYFDEFGIIRDVMQNHLLQILSLVAMEKPVSCHPDDIRDEKVKVLKSIE
TLTLKDMVLGQYLANPQGTTDDARMGYVEDPTVSNDSNTPTYALGVLKINNERWQGVPFI
LRCGKALNERKAEVRIQYQDVPGDIFEGSTKRNELVIRVQPGEALYFKMMTKSPGITFDI
EETELDLTYEHRYKDSYLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPILHQIERE
RVRPITYQYGSRGPKEADRMCEENNFKYSGSYKWHGGKAATSNR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggcaacgcaaaaggaagatcacaccgccctggatctcatcataaagtcgctcaagtcg
ccgaccatggtctgcgagggcacccacttcgacggcaagatcccgcacacgttcgtaatc
tttggggcgtcgggcgatctggccaagaagaagatctacccaacgctctggtggctctac
cgcgatgacctgctgcccaagccgaccaagttctgcggctatgcccgctccaagctgacg
gtcgacagcctcaaggaccagtgcctgccgtacatgaaggtccagttgcacgagcagaag
aagtacgaggagttctgggccctcaacgagtacgtatccggcagatacgacggacgcact
ggcttcgagctactcaaccagcagctggagctgatggagaacaagaacaaggccaaccgc
atcttctacctggccctgccgcccagcgtctttgaggaggtgacagtcaacatcaagcag
atctgcatgtcggtctgcggctggaaccgcgtgatcatcgagaagccctttggacgggat
gacgcctcctcgcaggcgctgagcgaccacctagccggtctgttccacgaggatcagctg
taccgcatcgatcactacctgggcaaggagatggtgcagaacctgatgaccatacgcttc
gcaaacaagatcctcagttcgacgtggaaccgcgagaacatcgcctccgtgctgatcacg
ttcaaggagcccttcggcacgcagggacgtggcggctactttgacgagtttggcatcatc
cgcgacgtgatgcagaaccatctgctgcagatcctgtcgctggtggccatggagaagccg
gtgagctgccacccggatgacatccgtgacgagaaggtcaaggtgctgaagagcattgag
accctgacgctgaaggacatggtgctgggccagtacctggccaatccgcagggcaccacc
gatgatgcgcgcatgggctacgtggaggaccccactgttagcaacgattcgaacacgccc
acttacgccctcggcgtgctcaagatcaacaacgagcgctggcagggcgtgccctttatc
ctgcgctgcggcaaggcgctgaacgagcgcaaggcggaggtgcgcatccagtaccaggac
gtgcccggcgacatcttcgagggcagcacgaagcgcaatgagctcgtcatccgcgttcaa
ccaggcgaggccctgtacttcaagatgatgaccaagagccccgggatcacctttgacatc
gaggagacggagctggacctcacctacgagcaccgctacaaggactcctacctgccggac
gcctacgagcggctcatcctcgacgtcttctgcggctcccagatgcactttgtccgctcg
gacgagctgcgcgaggcgtggcgcattttcacgcccattctgcatcagatcgagcgggag
cgcgtccgtccaatcacctaccagtacggttcgcgcggtcccaaggaagcggaccgcatg
tgcgaggagaacaacttcaagtactccggctcctacaagtggcacggcggcaaggcggcc
acgtccaatcgctaa

DBGET integrated database retrieval system