KEGG   Drosophila erecta: 6545778Help
Entry
6545778           CDS       T01060                                 

Definition
(RefSeq) pyrimidodiazepine synthase
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
der  Drosophila erecta
Pathway
der00480  Glutathione metabolism
der00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    6545778
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    6545778
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     6545778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 6545778
NCBI-ProteinID: XP_001971645
FlyBase: FBgn0106581
UniProt: B3NBS5
LinkDB All DBs
Position
Unknown
AA seq 241 aa AA seqDB search
MSSGKHLTKGSPKPALPDDGVLRLYSMRFCPYAQRAHLVLNAKNVPHHSIYINLTEKPEW
LVDVSPLLKVPALQLVAEKDQPSLIESLIIAEYLDEKYPENPLLPKDPLRRAQDKILLER
FSGITNAFMKILLQSTGLEDYWAALDIFEQELTKRGTPYFGGNKPGFVDYMIWPWFERLS
VIELKLQEEYNFDEARFPKISKWIALLKADSVVKSFYATPEQHNEFWRTRKAGNANYDLL
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagttctggtaaacatttgaccaaaggttcccccaaacctgccctccctgacgatgga
gttctccgcctgtactccatgaggttctgcccctacgcacagcgagcacatctcgtcctg
aatgccaagaatgtgccccatcacagcatttacatcaatctcaccgagaaaccagagtgg
ctggtggacgtgagcccactgcttaaggttcctgccctgcagctggtggcggagaaggat
cagccctcgctcatcgagtcgctgattattgccgagtatctggacgagaagtacccggag
aatccgctactgcccaaggacccattgaggcgggcccaggacaagattctgctggagcgc
ttcagcggcatcaccaatgccttcatgaagatcctgttgcagagcaccggtctggaggat
tactgggcggcgctggacatctttgagcaggagttgaccaagaggggtaccccatacttt
ggtggcaacaagcccggcttcgtggactacatgatctggccttggttcgaacgcctctct
gtgatcgagttgaagttgcaggaggagtacaactttgacgaggctcgcttccccaagatc
agcaagtggattgctcttctgaaggcggactcggtggtcaagtccttttatgccactccc
gagcagcacaacgagttctggcgcacccgcaaggccggcaatgcaaactacgatctgctg
gcttag

DBGET integrated database retrieval system