KEGG   Drosophila erecta: 6546304
Entry
6546304           CDS       T01060                                 

Definition
(RefSeq) cell death protein rpr
  KO
K20014  cell death protein rpr
Organism
der  Drosophila erecta
Pathway
der04214  Apoptosis - fly
der04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:der00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6546304
   04215 Apoptosis - multiple species
    6546304
SSDB
Motif
Pfam: Bunya_NS-S
Other DBs
NCBI-GeneID: 6546304
NCBI-ProteinID: XP_001972845
FlyBase: FBgn0107987
UniProt: B3ND78
LinkDB
Position
Unknown
AA seq 65 aa
MAVAFYIPDQATLLREAEQKEQQILRLRESQWRFLATVVLQTLRQYSPCHPKTGRKCGKY
RKPSQ
NT seq 198 nt   +upstreamnt  +downstreamnt
atggcagtggcattctacatacccgaccaggcgactctgctgcgggaggcggagcagaag
gagcagcagatcctccgcttgcgggagtcccagtggagattcctggccaccgttgtcctg
caaacgctgcgccagtacagtccatgtcatccgaagaccggaagaaagtgcggcaaatac
cgcaagccatcgcagtga

DBGET integrated database retrieval system