KEGG   Drosophila erecta: 6546305
Entry
6546305           CDS       T01060                                 

Definition
(RefSeq) cell death protein Grim
  KO
K20018  cell death protein Grim
Organism
der  Drosophila erecta
Pathway
der04214  Apoptosis - fly
der04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:der00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6546305
   04215 Apoptosis - multiple species
    6546305
SSDB
Motif
Pfam: DUF2367 DUF5045 TFIIA GAF_2 Spt20
Other DBs
NCBI-GeneID: 6546305
NCBI-ProteinID: XP_001972846
FlyBase: FBgn0107988
UniProt: B3ND79
LinkDB
Position
Unknown
AA seq 140 aa
MAIAYFIPDQAQLLARSYQQSGHQAAASPRTTAAPAAPLQQQQQAQQQQSQQQQQPHPQQ
QRPQFRANISVPLGSQQGSMTMSEFGCWDLLAQIFCYALRIYSYSSSQRRPMVIQISFEI
SSGGQNNEEDDVTDATSKEN
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccatcgcctatttcatacccgaccaggcccaattgttggccagaagctatcagcaa
agcggccaccaggcagcagcgagtccaaggacaactgcagcacctgctgcacccttgcag
cagcagcaacaagcgcaacagcaacaatcgcaacagcagcagcagccacatccacaacaa
cagcgcccccaattccgtgccaacatttccgtgccgctgggaagtcaacagggatcgatg
acaatgtcggagttcggatgctgggaccttctggcccagatcttctgctacgccctgaga
atctacagctacagttcgagccagcgaagaccgatggtgattcaaatatccttcgaaatc
agcagcggcggtcagaacaacgaggaggacgatgtgaccgatgccacctccaaggagaac
tag

DBGET integrated database retrieval system