KEGG   Drosophila erecta: 6546307
Entry
6546307           CDS       T01060                                 

Definition
(RefSeq) transketolase-like protein 2
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der01100  Metabolic pathways
der01200  Carbon metabolism
der01230  Biosynthesis of amino acids
Module
der_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
der_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6546307
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    6546307
Enzymes [BR:der01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     6546307
SSDB
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Other DBs
NCBI-GeneID: 6546307
NCBI-ProteinID: XP_001972848
FlyBase: FBgn0107990
UniProt: B3ND81
LinkDB
Position
Unknown
AA seq 623 aa
MSNAKLDSKVVQNLKDIAQKLRIHSITSTQAAKSGHPTSCASLAEIITVLFFQQMRLNMK
HPRDPSSDRLVLSKGHAAPILYAAWAEAGLFPVEELRNLRKVDSDLEGHPTPRLSFIDVS
TGSLGQGISVAAGMAYVGKYLDKADYRTYVIVGDGEASEGAVWESLHFAGHYCLDNLCVI
FDMNKFFCSDIGTELEVYRERLDAFGFNALVLNGHDIDELVKAFFNAASTKGKPTALLAK
TVKGKDFLAIEGVDEMHAQPLGKRAEAAIKHLQMKIANPNVRLSPKKLGKCGHAPEVHIN
NIRLCSPPNYRLGDAVAPRLAYGTALAKIAADNSRVIALDGDTKNSTYADKMRNAFPERF
IECFTAQQNLVGVAVGATCRRRTVAFVSTYATFFTRAFDQIRMGAISHTNVNFAGSHCGC
SIGEDGPSQMGLEDIAMFRSIPGSTVFYPTDAVSTERAVELAANTKGVCFIRTTYPNTTV
IYNNDEVFAVGMGKVVRQKPSDEVLLIGAGVTLYECLAAAERLEEDCITARVLDPFTVKP
LDVQLILKHGKLCHGRIVVAEDHYQQGGLGEAVLSALADYRNFVVKHLYVTNVPRSGPPA
VLLDMFGVSSRNIYKASVAIMKK
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgtcgaacgctaagctggacagtaaggtcgtgcagaacctgaaggacattgcccagaag
ctgcggatccactcgatcacctcgacgcaggcggccaagtcgggtcacccgacgtcctgt
gcctcattggccgagataataacggtgctgttcttccagcagatgcgcctgaatatgaag
catcctcgcgatccctccagcgatcgattggtgctatccaaaggacacgctgcgcccatc
ctgtacgccgcctgggcggaggcaggactctttccggtggaggagctgcggaatctgcgc
aaggtggacagcgatcttgagggccatcccactccgcggctgagtttcatcgatgtgagc
actggatccctgggacagggcatctccgtggccgccggcatggcctatgtgggcaaatac
ctggacaaggccgactatcgcacctatgtgattgtgggcgatggcgaggccagcgaagga
gccgtctgggaatcgctccactttgccggccactactgcctggacaacctgtgcgtcatt
ttcgacatgaacaagttcttctgctcagacattggcactgaactggaggtctaccgggag
cggttggacgccttcggcttcaatgccctagtcctgaatggccacgatattgacgagctg
gtcaaggccttcttcaatgcggccagcaccaagggcaagcccacggctctgctggccaag
acggttaagggaaaggactttctggccatcgagggagtcgacgaaatgcatgcccagcca
ttgggcaagcgggccgaggctgcgatcaagcacttgcagatgaaaatcgccaatccgaat
gtgcgcctgtcgcccaaaaagctgggcaagtgcggccacgcccccgaggtgcatatcaac
aacatacggctgtgcagtccgcccaattatcggctgggagatgcggtggctccacgttta
gcctacggaaccgcactggccaagatcgcggccgacaactcccgggtcatagccctcgat
ggcgacacaaagaactccacgtacgcggacaagatgcggaatgcgtttccggagcgcttc
atcgagtgcttcacggcgcagcagaatctggtgggcgtggccgtgggagcaacctgtcgc
cgacgcactgtggccttcgtctccacgtatgccaccttcttcacccgggcattcgatcag
atccgcatgggcgccatttcgcacacgaatgtgaacttcgcgggctcccactgcggctgc
agcattggtgaggatggtccatcccagatgggactggaggacatagccatgttcaggagc
attcccggtagcacggtcttctatcccacggatgcggttagcacggagagggcggtggaa
ctagctgctaatacgaagggcgtgtgcttcatccgcaccacgtatccgaacaccacggtg
atctacaacaatgacgaggtgtttgccgtgggaatgggcaaggtggtgcgccagaagccc
tcggatgaggtgctcctgattggagccggtgtcacactgtacgagtgcctagccgcagcg
gagagattggaggaggactgcatcacggcgcgcgtgctggaccccttcacagtgaagccc
ctcgatgtgcaactaatcttgaagcacggaaaactgtgccatgggaggatcgtggtggcc
gaggatcactaccagcaaggcggactgggcgaggcggtgctcagtgccttggccgactat
cgcaactttgtggtcaagcatctctatgtgaccaatgtaccgagatcaggtcctcccgcc
gttctgctggacatgtttggtgtctcttccaggaacatctacaaagctagcgtggccatc
atgaagaagtga

KEGG   Drosophila erecta: 6552447
Entry
6552447           CDS       T01060                                 

Definition
(RefSeq) transketolase-like protein 2
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der01100  Metabolic pathways
der01200  Carbon metabolism
der01230  Biosynthesis of amino acids
Module
der_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
der_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6552447
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    6552447
Enzymes [BR:der01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     6552447
SSDB
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh DXP_synthase_N TPP_enzyme_C XFP_N
Other DBs
NCBI-GeneID: 6552447
NCBI-ProteinID: XP_001980936
FlyBase: FBgn0104025
UniProt: B3P4V0
LinkDB
Position
Unknown
AA seq 626 aa
MSYHKPEAKTVQDLKDLAQKLRIHSINATQASKSGHPTSCASIAEIMSVLFFQQLRLNLK
HPRDPSSDRFILSKGHAAPILYAAWAEAGLFPIEDLNNLRKIDSDLEGHPTPRLNFIDVG
TGSLGQGVAVGAGMAYVGKNFDKADYRTYVVVGDGESAEGSIWESLHFAGHYKLDNLCVI
FDVNRLGQSEATSLQHKLDVYRDRLEAFGFNAVVVDGHDVEELSKAFHCAAITKNKPTAI
IAKTFKGRDFPNIEDLDNWHGKPLGDKAAEVVKHLQGLIVNKNVKLAPKPVPKTGAAPDV
DISNIKLSSPPAYKLGDSIATRLAYGTALAKIGQNNLRVVALDGDTKNSTFSDKLKKLDP
ERYIECFIAEQNLVGVAVGAACRRRTVAFVSTFATFFTRAFDQIRMGAISQTNVNFVGSH
CGCSIGEDGPSQMGLEDIAMFRTIPGSTIFYPSDAVSTERAVELAANTKGVCFIRTSRPN
TCVIYDNEEPFTIGRGKVVRQKSSDEVLLIGAGITLYECLAAADQLEKNCITVRVIDPFT
VKPLDAELIIEHGKQCGGRVVVVEDHYQQGGLGEAVLSALAGERNFVVKHLYVPTVPRSG
PPSVLIDMFGISARHVVNAVNEILKD
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgtcgtaccacaagcccgaagctaagactgtccaggatctgaaagatctggcccagaag
ctgcgcattcactccatcaacgccacccaggcctccaaatcgggacatcccacatcatgt
gcctcgatcgccgagatcatgtccgtgctgttcttccagcagctgcgcctgaacttgaag
cacccgcgcgatccctccagcgatcgattcatcctgtccaagggacacgccgctcccatt
ctgtatgccgcctgggctgaggccggtctcttccccatcgaggatctgaataacctgcgc
aagatcgacagcgatctggagggtcacccgacgccccgtctgaacttcatcgatgtgggc
accggatccctgggacagggagtcgccgtcggcgctggaatggcctatgtgggcaagaac
ttcgacaaggctgactatcgtacctacgtggtcgtgggtgatggtgagtccgctgagggt
tccatctgggagtcgctgcactttgccggccactacaaactggacaacctttgcgtgatc
ttcgatgtgaaccgcttgggtcagtcggaggccacttccctgcagcataagctggatgtt
taccgggatcgcctggaggctttcggcttcaacgctgtcgttgtcgatggtcatgatgtc
gaggagttgtccaaggctttccattgtgctgccatcaccaagaacaagcccaccgccatc
attgcgaagacgttcaagggcagggacttccccaatatcgaggatttggacaactggcac
ggcaagccactgggcgacaaggccgccgaagtggtgaagcatctgcagggactgattgtc
aacaagaatgttaagctggcccccaagccggtgcccaagactggcgctgctcccgatgtg
gatatcagcaacattaagttgagctcaccacccgcctacaagctgggtgattccattgcc
acccgattggcgtatggaacagccctggccaagattggccagaataacctgcgtgtggtt
gccctggacggagacaccaagaactctactttctccgacaagctgaagaaacttgacccg
gagcgctacattgagtgcttcatcgctgagcagaatcttgtgggagtggccgttggagcc
gcctgccgtcgccgcactgtggcctttgtgtccacctttgccaccttcttcacccgtgca
ttcgatcagatccgtatgggcgccatttcacagacgaacgttaactttgtgggctcccac
tgcggctgcagcatcggtgaggatggtccctcgcagatgggcctggaggacattgccatg
ttccgcaccattccgggcagcaccatcttctatccctctgatgcagtgagcacggagcgt
gccgtcgaactggccgccaacaccaagggtgtctgcttcatccgtacttcccgtcccaac
acctgcgtgatctacgacaacgaggaacccttcaccattggccgcggaaaggtggtgcgc
caaaagagctctgacgaggtgctcctgatcggagctggaatcactttgtacgagtgcttg
gctgccgccgatcagctggagaagaactgcatcaccgtccgtgtgatcgatcccttcacc
gtgaagcccttggacgccgagctgattatcgagcacggcaagcagtgcggaggacgtgtg
gtcgtcgtggaggatcactaccagcaaggtggtctgggcgaagctgtgctgagtgccctg
gctggcgagcgcaactttgtggtcaagcacttgtacgtgcccaccgttccacgctcgggt
cctccgtcagtcctcatcgatatgttcggtatctccgcccgccacgtcgtcaacgccgtc
aacgagatcctcaaggattag

DBGET integrated database retrieval system