KEGG   Drosophila erecta: 6546547
Entry
6546547           CDS       T01060                                 

Definition
(RefSeq) deoxyribose-phosphate aldolase
  KO
K01619  deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6546547
Enzymes [BR:der01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     6546547
SSDB
Motif
Pfam: DeoC DUF4516
Other DBs
NCBI-GeneID: 6546547
NCBI-ProteinID: XP_001975912
FlyBase: FBgn0112494
UniProt: B3NS10
LinkDB
Position
Unknown
AA seq 346 aa
MGSMDVKELEVNKTLPFDPSLLKVNISLRQVEEIAMTVSQRCHVNGANEIAWALRALMLT
DLTTLAGDDTAANVRRLCLRACYPFEPQFFDRFFDRALIPEMHTAAVCVYPARVKDAYTT
LQQYDKLDKVAIAAVATGFPTGQYGLQTRLQEISHAILAGATEIDIVINRQLALVGDWEA
MYNEVVLMRSACGQRAHLKTILAIGELGTMENVYKAAMVCMMAGADFIKTSTGKETVNAT
LPVGLVMIFAIQEFKRRTCQIVGLKPAGGVKTVRDAIAWMTLVNETLGIRWLRPERFRFG
ASGLLDDIERVVREGVKKLEEEEAQKNVPVSREAAAAETFCKELRK
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgggcagcatggatgtgaaggaactggaagtaaacaaaaccctgccctttgacccctcc
ctgcttaaggtgaacatctccctgcggcaggtcgaggagatcgccatgacagtgtcccag
cggtgccatgtcaacggagccaacgaaatcgcctgggcgttgagggctctgatgctgacg
gatctgaccaccttggctggcgatgatacggcggccaatgtgcggagactgtgcctacgc
gcctgctatcccttcgagccgcagttcttcgacaggttctttgaccgggctctcatccca
gagatgcacactgccgccgtatgcgtttatccggccagggtaaaggatgcctatacaact
ctacagcagtacgacaaactggataaagtggccattgctgcggtggctacgggctttccc
acgggccagtatggcctgcagacccgcctgcaggagattagccacgccatcctggctggt
gccacagagatcgacattgtgatcaatcgccagttggccctagttggcgactgggaggcc
atgtacaacgaggtggtcctcatgcgcagcgcctgtggacaaagggctcaccttaaaact
attcttgccatcggggagctgggaaccatggagaatgtctacaaagcagccatggtttgc
atgatggccggagcggatttcataaagacgtccactggaaaggagacggtcaacgccacc
ctgcccgttggcctggtcatgatatttgccattcaggaattcaaacgtcgcacgtgccag
attgtgggccttaagccagccggaggagtaaagactgtgcgagatgcaatcgcctggatg
acgttggttaacgaaactcttggcattcgctggttgcgccctgagaggttccgttttgga
gcttccggactgctagacgacattgaacgtgttgtacgtgagggtgtcaaaaaactcgaa
gaggaggaggctcagaaaaacgtgcccgtgtctcgcgaggctgctgctgccgagaccttc
tgcaaggagttgcgcaaatag

DBGET integrated database retrieval system