KEGG   Drosophila erecta: 6546601
Entry
6546601           CDS       T01060                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog B
  KO
K20017  Bcl-2 family protein
Organism
der  Drosophila erecta
Pathway
der04214  Apoptosis - fly
der04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:der00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6546601
   04215 Apoptosis - multiple species
    6546601
SSDB
Motif
Pfam: Bcl-2 DUF3760
Other DBs
NCBI-GeneID: 6546601
NCBI-ProteinID: XP_026836093
FlyBase: FBgn0112405
LinkDB
Position
Unknown
AA seq 298 aa
MPGTSYPTNNDNFSNGFPMANTQSERLLQAQNRRKFSFPATLHSASLLEVGGGPKETTRR
RLSNVSDAVTRKLSYTIGWKAAQIPAQDIISQGRCLCGHYIKRRLRRSGLFNKKLGLQRI
RSILGSTSMGIVRDVFPAVQVLGDELERMHPRVYNGVARQICRNPGGEFHTPDAVSLLLG
AVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINE
NGGWSGINTHVLPTNNSLNPLEWTTLVIGVVFGLILVFMIVRFIFNLIVPKIYQRFTN
NT seq 897 nt   +upstreamnt  +downstreamnt
atgcccggcacctcgtatcccacgaataatgataatttcagcaacggatttccgatggcc
aacacacaaagtgagcgcctcttgcaggctcagaatcgaagaaagttcagttttccagcc
accctccattcggcatcacttctggaggtgggtggtggccccaaggagaccacgaggcgg
aggttaagcaatgtgagcgatgccgtcaccaggaaactatcctatacgattggctggaag
gcggcacagattccagcgcaggatatcatttctcagggtcgctgcctgtgcggtcattat
atcaagagacgtcttagaagatccggtttgttcaataaaaagctgggactgcagcgcata
cgtagcatactgggttccacctccatgggcattgtgcgagatgtgtttcctgcggtccaa
gtgctgggcgatgagctggagcgcatgcatcccagagtttacaacggagtggctcgtcag
atttgccggaatccgggtggcgagttccatactccggatgcagtgagcttgcttttgggc
gccgtggggcgggagctctttcgggtggagatcacctggagcaaggtgatctcattgttt
gccatcgccggtgggctgtccgttgactgtgtgcgtcaaggacatccggaatacctgccc
aagttgatggagagcgtttcggaggtgatcgaagatgagctggttccgtggattaacgag
aatggtggttggagcggcatcaacacacatgttttacccactaacaacagcctgaatcct
ttagagtggaccactttggtcataggcgttgtttttggcctaattctagtttttatgatt
gtgcgatttatatttaacttaattgtacctaaaatatatcagcgatttacgaattga

DBGET integrated database retrieval system