KEGG   Drosophila erecta: 6547180Help
Entry
6547180           CDS       T01060                                 

Definition
(RefSeq) trypsin delta-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
der  Drosophila erecta
Pathway
der04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:der00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    6547180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:der01002]
    6547180
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:der04147]
    6547180
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     6547180
Peptidases [BR:der01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   6547180
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   6547180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 6547180
NCBI-ProteinID: XP_001976078
FlyBase: FBgn0015081
UniProt: B3NSH6
LinkDB All DBs
Position
Unknown
AA seq 253 aa AA seqDB search
MLKFVILLSAVACALGATIPEGLLPQLDGRIVGGTATTISSFPWQISLQRSGSHSCGGSI
YTDRVIVTAAHCLQSVSASSLQIRAGSSYWSSGGVTVKVSSFKNHEGYSARTMVNDIAVI
RLSSSLSFSSTIKSISLASSNPPNGAAASVSGWGTQSSGSNSIPSQLQYVNVNIVSQSRC
ASSTYGYGSDIRDTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGQGCAYSNYPGVYA
SVADLRAWVVRNA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagttcgtgatcttgttgtctgcagtagcctgcgccctgggagccaccatcccc
gagggtctcctgccccagttggatggccgcattgtcggcggtactgctaccaccatcagc
agcttcccctggcagatctccctgcagcgcagtggaagccactcctgcggtggatccatc
tacaccgacagggtgatcgtgaccgccgctcactgtctgcagtccgtgtccgcctcctcc
ctccagatccgcgctggatccagctactggagctctggtggcgtcaccgtcaaggtttcc
tctttcaagaaccacgagggatacagcgccagaaccatggtcaacgacatcgctgtgatc
cgtctgagctcctccctgagcttcagctccaccatcaagtccatctctctggctagctcc
aacccccccaacggcgctgctgcttccgtctccggatggggcactcagtcgtccggatcc
aactccatcccctcccagctgcagtacgtgaacgtgaacatcgtcagccagagcaggtgt
gcttcctccacctacggatacggtagcgacatccgcgacaccatgatctgtgctgctgcc
agcggcaaggatgcctgccagggtgactccggtggcccactggtctccggcggagttctt
gtcggtgttgtctcctggggacaaggatgcgcttactccaactaccccggtgtctacgcc
agcgtggctgacctccgcgcctgggtggtcaggaacgcctaa

DBGET integrated database retrieval system