KEGG   Drosophila erecta: 6547422Help
Entry
6547422           CDS       T01060                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
der  Drosophila erecta
Pathway
der00020  Citrate cycle (TCA cycle)
der00190  Oxidative phosphorylation
der01100  Metabolic pathways
der01200  Carbon metabolism
Module
der_M00009  Citrate cycle (TCA cycle, Krebs cycle)
der_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
der_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6547422
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6547422
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     6547422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like TBK1_CCD1
Motif
Other DBs
NCBI-GeneID: 6547422
NCBI-ProteinID: XP_015011852
FlyBase: FBgn0113095
UniProt: B3NJU5
LinkDB All DBs
Position
Unknown
AA seq 661 aa AA seqDB search
MSGIMRVPSILAKNAVASMQRAAAVGVQRSYHITHGRQQASAANPDKISKQYPVVDHAYD
AIVVGAGGAGLRAAFGLVAEGFRTAVITKLFPTRSHTIAAQGGINAALGNMEEDDWKWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTQDGKIYQRAFGGQSLKFGKG
GQAHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLIFEDGECRGVLALNLEDGT
LHRFRAKNTVIATGGYGRAFFSCTSAHTCTGDGTAMVARQGLPSQDLEFVQFHPTGIYGA
GCLITEGCRGEGGYLINGNGERFMERYAPVAKDLASRDVVSRSMTIEIMEGRGAGPEKDH
VYLQLHHLPPKQLAERLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYRGQVIT
IDKDGKDVIVPGLYAAGESASSSVHGANRLGANSLLDLVVFGRACAKTIAELNKPGAPAP
TLKENAGEASVANLDKLRHANGQITTADLRLKMQKTMQHHAAVFRDGPILQDGVNKMKEI
YKQFKDIKVVDRSLIWNSDLVETLELQNLLANAQMTIVSAEARKESRGAHAREDFKVRED
EYDFSKPLDGQQKKPMDQHWRKHTLSWVCNDNGDITLDYRNVIDTTLDSEVSTVPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaatcatgcgtgtgccatcgattttggccaaaaatgctgtcgcctccatgcaa
cgtgccgcagccgttggagtgcagcgcagctaccacatcacacacggccgccagcaggcc
tcggcggcgaatccggacaagatatctaaacagtacccggtggtggatcacgcctacgat
gcgatcgtcgtgggagcaggaggagctggcctgcgggcggcttttggcctggtggctgag
ggattccgcacggcggtgatcaccaagttgttccccacccgctcgcacacgatcgccgcc
cagggcggtatcaatgcggctctgggtaacatggaggaagacgattggaagtggcacatg
tacgacacggtcaagggctccgattggctgggcgaccaggatgccatccactacatgacg
cgcgaggcgcccaaggctgtcattgagcttgagaactacggcatgcccttctcgcgtacc
caggacggaaagatctaccagcgcgccttcggtggacagagtctgaagttcggcaaaggc
ggacaggcccatcgctgttgtgctgtggctgatcgtactggtcactcgctgctgcacacg
ctctacggtcaatccctgagctacgactgcaactacttcgtggagtactttgccctggat
ctgatcttcgaggatggcgagtgccgtggtgtgctggctctgaacctggaggatggcaca
ctgcaccgattccgcgctaagaacacggtcattgccaccggcggttatggacgcgccttc
ttctcctgcacctcggcgcacacatgtaccggtgacggtaccgccatggttgcccgtcag
ggcctgccctctcaggatttggaattcgtgcagttccatcctactggtatctacggcgcc
ggctgtctcatcaccgagggctgccgcggtgagggtggttacctgatcaacggtaatggc
gagcgcttcatggagcgttatgctcctgtggccaaggatctggcctcccgcgacgtcgtc
tcgcggtcgatgaccatcgagatcatggagggtcgtggcgccggacccgagaaggatcac
gtttacctgcaattgcaccacttgccgcccaagcagctcgccgagcgtctgcctggcatc
tccgagaccgccatgatctttgccggtgttgatgtgacccgcgagcccatccccgtgttg
cccaccgtgcactacaacatgggtggtgtgccgaccaactaccgcggccaggtaatcacc
attgataaggatggcaaggatgtgattgtgccaggactgtatgccgctggcgagtctgct
tccagctcggtgcatggtgccaaccgtctgggtgccaactctctgctggatctggtggtc
ttcggacgtgcgtgcgccaaaactatcgccgagctgaataagcccggtgcaccggctccc
accctcaaggaaaacgctggcgaggcctctgtggccaacctggataagctgcgccatgcc
aacggccagatcaccaccgccgatctgcgtctgaagatgcagaagaccatgcagcatcat
gctgctgtgttccgtgatggtcccatcctccaggatggtgtgaacaagatgaaggagatc
tacaagcagttcaaggacatcaaggttgttgataggtcgcttatctggaactctgatctg
gtggagacgctggagctgcagaacttgttggccaatgcacagatgactattgtgagcgct
gaggcgcgcaaggaatcgcgaggtgcccatgcccgtgaggacttcaaggttcgcgaggat
gaatacgatttcagcaagcccctcgacggtcagcagaagaagcccatggatcagcattgg
cgcaagcacacgctctcgtgggtgtgcaatgacaacggagacataacgctggactacaga
aacgtgatcgataccacgctggacagcgaagtctctactgttccaccagcgattcgctcc
tattaa

DBGET integrated database retrieval system