KEGG   Drosophila erecta: 6547762
Entry
6547762           CDS       T01060                                 

Definition
(RefSeq) ribose-5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der01100  Metabolic pathways
der01200  Carbon metabolism
der01230  Biosynthesis of amino acids
Module
der_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
der_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6547762
Enzymes [BR:der01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     6547762
SSDB
Motif
Pfam: Rib_5-P_isom_A
Other DBs
NCBI-GeneID: 6547762
NCBI-ProteinID: XP_001976384
FlyBase: FBgn0115000
UniProt: B3NPC1
LinkDB
Position
Unknown
AA seq 277 aa
MLSGLLRRGVQPARFTQHLGEDLLRSAAALHSQVRRMEDIALDAAKKTAARTAVDQWVTE
DTKILGIGSGSTVVFAVQRIAERVWKEGELTDLICVPSSYQARHLILDYNLNLGDLDRNP
NIDVAIDGADEVDRHMVLIKGGGGCLLQEKVVASCAKNFIVVADYTKNSIRLGEQWCRGV
PIEVAPMAYVPIKLHIEALFGGEASLRMAKVKAGPIVTDNGNFLLDWKFIANREYDWDEV
NRAITLIPGVLETGLFVNMATKCYYGMADGQVKVQNK
NT seq 834 nt   +upstreamnt  +downstreamnt
atgttatctgggttattgcgtcgaggcgtccaaccagcacggttcacccagcatctcggc
gaagatctcttacgcagcgcagcggcattacactcccaggttcgcaggatggaagacatt
gctttggacgcggccaagaagacggcggcccgcacggcggtggatcagtgggtaacggag
gacacgaagattctggggataggcagtgggtccaccgtggtgttcgccgtgcagcggatc
gcggagcgcgtgtggaaggagggtgagctgacggacctcatctgtgtgccctcgtcctac
caggcgcgccatctgatcctcgactataacctcaacctgggcgatctggacaggaatccc
aacatagacgtggccatcgacggggccgacgaggtcgaccgacacatggtgctcatcaag
ggaggcggcggctgtttgctgcaggagaaggtggtggcctcctgcgccaagaacttcatc
gtggtggccgattacacaaagaactccatccgtctgggggagcagtggtgccgcggagtg
cccatcgaggtggcccccatggcgtacgtgcccatcaagctgcacatcgaggcgctcttc
ggcggggaggcctctctacggatggccaaggtgaaggcgggacccatcgtcacggataat
ggcaacttcctgctggactggaagttcatcgccaaccgggagtacgactgggacgaggtc
aaccgcgccatcaccctgatcccgggcgttctggagacgggtctgttcgtcaacatggcc
accaagtgctactacggcatggccgatggccaggtcaaggtccagaataagtag

DBGET integrated database retrieval system