KEGG   Drosophila erecta: 6547884
Entry
6547884           CDS       T01060                                 

Definition
(RefSeq) caspase-1 isoform X2
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
der  Drosophila erecta
Pathway
der04214  Apoptosis - fly
der04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:der00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    6547884
   04215 Apoptosis - multiple species
    6547884
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:der01002]
    6547884
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     6547884
Peptidases and inhibitors [BR:der01002]
 Cysteine peptidases
  Family C14: caspase family
   6547884
SSDB
Motif
Pfam: Peptidase_C14 DUF4347
Other DBs
NCBI-GeneID: 6547884
NCBI-ProteinID: XP_001976428
FlyBase: FBgn0115023
UniProt: B3NPN7
LinkDB
Position
Unknown
AA seq 323 aa
MTDECVTRNYGVGILSPNGAANRGSYNADNTDAKGCTPEAVVGGATAASASSLPANKFVA
RMPVERYASEYNMNHKHRGIALIFNHEYFDIPSLKSRTGTNVDAQELKKAFENLGFSVSV
YKDCKLRDILKHVEKAAEQDHADNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATF
CPSLAGKPKLFFIQACQGDRLDGGITLEKSVTETDGESSTSYKIPIHADFLFSYSTIPGY
FSWRNINNGSWYMQSLIRELNANGKKYDILTLLTFVNQRVALDFESNVPATPMMDRQKQI
PCLTSMLTRILRFGDKPNGNKAG
NT seq 972 nt   +upstreamnt  +downstreamnt
atgaccgacgagtgcgtaactagaaactacggagttggaattctcagcccgaacggagcg
gcaaatcggggcagttataatgctgataataccgatgccaagggctgtacgccggaggcg
gttgttggtggtgcaactgcagcgagtgcctcatccctgccggccaacaagtttgtggcc
cgaatgcccgtggagcgttatgccagcgaatacaacatgaatcacaagcaccgcggaata
gccctgatcttcaaccacgagtacttcgacataccctcgctgaagagtcgcaccggaacg
aatgtagatgcccaggagctgaagaaggcctttgaaaacctgggattttcggtgtccgtg
tacaaggactgcaagttgagggacatcctgaagcacgtggaaaaggccgccgagcaggat
cacgcggacaacgactgccttgcggtggccatcctctcccacggggagcacggctacctg
tacgccaaggatacgcagtacaagctggacaacatttggcactacttcactgccaccttt
tgcccctcgttggcgggcaagccgaagctgttcttcatccaagcctgccagggcgatcgt
ttggacggagggattactctggagaagagcgttaccgagacggatggcgagtcctcgacg
agctacaagatacccatacacgctgactttctattctcctactctaccatcccgggctac
ttctcctggcgcaacatcaacaacgggtcctggtacatgcagtcgctgatccgcgagcta
aatgccaatggcaagaagtacgacatactcaccctgctcacattcgtaaaccagcgcgta
gccctagactttgagtcgaacgtgcccgccactccgatgatggatcgccagaagcagata
ccgtgcctcacctccatgctgacgcgcatactgcgcttcggcgacaaaccgaacggcaat
aaggctggctaa

DBGET integrated database retrieval system