KEGG   Drosophila erecta: 6548005
Entry
6548005           CDS       T01060                                 

Definition
(RefSeq) probable transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
der  Drosophila erecta
Pathway
der00030  Pentose phosphate pathway
der01100  Metabolic pathways
der01200  Carbon metabolism
der01230  Biosynthesis of amino acids
Module
der_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
der_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:der00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    6548005
Enzymes [BR:der01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     6548005
SSDB
Motif
Pfam: TAL_FSA Phage_connector KTI12
Other DBs
NCBI-GeneID: 6548005
NCBI-ProteinID: XP_001976500
FlyBase: FBgn0115062
UniProt: B3NQ27
LinkDB
Position
Unknown
AA seq 331 aa
MGSDRTLKKQKMSVLQELKKITTIVADTGDFEAINIYKPTDATTNPSLILSASSMERYQP
LVQKAVEYAKGKKGSVSEQVAEAMDYLCVLFGTEILKVVPGRVSTEIDARLSFDTKKSVE
KALKLIGLYKSLGVDKERILIKLASTWEGIKAAEILENEHGVHCNLTLLFSFAQAVACAE
AGVTLISPFVGRILDWYVANTETKKFEALKDPGVISVTNIYNYYKKFGYKTLVMGASFRN
VGEIKALAGCDLLTISPSLLKELENETESVVTYLSVSNAKLQDIEKITVDESRFRWLLNE
DAMATDKLSEGIRKFAVDTVKLENLIKTYLK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgggaagtgatcgcacgttgaaaaagcaaaagatgtcggtactacaggaactcaagaaa
atcaccaccattgtggctgacaccggcgactttgaagctatcaacatctacaagcccacg
gatgccacgaccaatccgtcgctcatcttgtccgcttcatccatggagcggtaccagccg
ctggtccaaaaggcggtggagtacgccaagggcaagaagggctccgtgagtgagcaggtg
gccgaggccatggactacctgtgcgtgctgttcggaacggaaatcctgaaggttgtcccc
ggtcgcgtttccaccgagatcgatgcccgcctgtccttcgataccaagaagagcgtggag
aaggcactgaagctcattggcttgtacaaatccctgggcgtcgacaaggagcgcatcctg
atcaagctggcctccacctgggagggcatcaaggcggccgagatcctggagaacgagcac
ggcgtgcactgcaacctgacgctcctcttctcgtttgcacaggccgtggcctgcgccgag
gcgggcgtgaccctcatctcgccattcgtgggccgcatcctggactggtacgtggccaac
acggaaaccaagaagttcgaggccctcaaggacccgggcgtaatctccgtgaccaacatc
tacaactactacaagaagttcggctacaagaccctggtcatgggcgcctccttccggaac
gtgggcgaaatcaaggccctggctggctgcgatctgctcaccatcagcccatcgctgctc
aaggagctggagaacgagaccgagtcggtcgtcacctacctgtccgtgagcaacgccaag
ctgcaggacatcgagaagatcaccgtcgacgagagccgattccgctggctgctcaacgag
gacgccatggccaccgacaaactgtccgagggcatcaggaagttcgccgtggatactgtt
aagctggagaatttaattaagacctatcttaagtag

DBGET integrated database retrieval system